Changes for page Archeologische indicatie
Last modified by TerraIndex TerraIndex on 2022/06/10 12:44
edited by TerraIndex TerraIndex
on 2022/05/20 15:21
on 2022/05/20 15:21
edited by TerraIndex TerraIndex
on 2022/06/10 12:44
on 2022/06/10 12:44
Change comment:
There is no comment for this version
Summary
-
Page properties (2 modified, 0 added, 0 removed)
Details
- Page properties
-
- Title
-
... ... @@ -1,1 +1,1 @@ 1 -Archeologi scheindicatie1 +Archeological indication - Content
-
... ... @@ -10,297 +10,339 @@ 10 10 ))) 11 11 ))) 12 12 13 -= Glas =13 += Pollen and spores = 14 14 15 -== Aardenvoorkomen ==15 +== Nature and occurence == 16 16 17 - Glasontstaat wanneer eenmengselvan silicium metkaliumofsodiumof lood, en calcium wordtblootgesteldaaneenhogetemperatuur.Bij circa 1000gradenCelsiusinopenvuurontstaateenglasachtiggekristalliseerdesubstantie, ondoorzichtig maarmet een dichtestructuur dienavermaling,door middelvan hitteverkit:faience.Hetwordtvoornamelijkaangetroffeninevormvan kralen.Ze kunnenvariëreninkwaliteit vansolidetotbrokkelig. In geslotenovensmet een hogere temperatuur waarbij glas smelt(<1200 graden Celsius), komthetzoweltransparantalsopaak(ondoorzichtig) voor, afhankelijk van toevoegingvan kleurendemetaaloxidenenbrandatmosfeer.Glaskomen weinveelverschillendekwaliteiteninde bodem tegen. Vaakis hetoudtijds gebrokenenals afvalgedumpt.Het glas (ookhet glasvande hoogstekwaliteit)isdoor mechanische(druk)krachtgefragmenteerd. Glas isgevoeligvoorvocht. GlaswerkuitRomeinse-enVroegmiddeleeuwsegraven isin veel gevallennoggaafaan te treffen.Laat- en postmiddeleeuwsgebruiksglasis vaakvan slechte kwaliteitwaardoor het voor vocht extragevoeligis.Onzuiveresamenstellingvande(kwalitatiefmindere)grondstoffen,tekortebrandtijdvanhetmengseln/oftelagebrandtemperatuurzijn daardebetaan. Ookdebodemsamenstellingheeftinvloedopde kwaliteit enonserveringvan hetglas.OnderzoekGlas biedtveelonderzoeksmogelijkhedenop sociaal-economischgebied,waaronderde reconstructievanhandelsroutes en-betrekkingenen technologischeontwikkelingeninhetverleden.Dehogestatus dieglaswerkin veelperiodesgenoot,resulteerdeinmodegevoeligeproductenwaardoor de verschillendemodellen elkaarsnelopvolgden.Glazenoorwerpenhebbentvanwegede fragiliteit doorgaanseenrelatiefkortelevensduur.Glazen objecten zijn daaromzeer geschiktvoorhet vaststellenvandedateringvanarcheologischecomplexen. Bij hetglasonderzoek wordenkwalitatieve (zoalsbijvoorbeeldkleur,hoedanigheidenfunctievanhet voorwerp)enkwantitatieve eigenschappen (zoalsaantalscherven,gewicht,fragmentatiegraad,en minimum aantalexemplaren) vastgesteld.Bij voorwerpen en, inminderemate,scherven kandoormiddel vantypo-chronologiede relatievedateringwordenbepaald.><1200gradenCelsius),komt hetzoweltransparantalsopaak(ondoorzichtig)voor,afhankelijk vantoevoegingvankleurendemetaaloxidenen brandatmosfeer.Glaskomen wein veelverschillendekwaliteitenindebodemtegen. Vaak ishetoudtijds gebrokenals afval gedumpt. Het glas(ookhetglas vane hoogste kwaliteit) is doormechanische(druk)kracht gefragmenteerd. Glasis gevoelig voor vocht. GlaswerkuitRomeinse-Vroegmiddeleeuwsegraven is in veel gevallen noggaaf aan tetreffen. Laat- enpost middeleeuwsgebruiksglasisvaak van slechte kwaliteit waardoorhet voorvochtxtragevoeligis.Onzuivere samenstellingvan de (kwalitatief mindere) grondstoffen, te kortebrandtijdvanhet mengsel en/oftelage brandtemperatuurzijn daardebetaan.Ook de bodemsamenstellingheeftinvloedop de kwaliteit en conserveringvan hetglas.17 +Pollen (pollen grains) and spores are microscopic products of plants, measuring between 5 and 100µm. Some pollen grains, such as those of corn, are larger. The material is collected by taking soil samples in places where one expects to find this material. During the analysis phase, in addition to pollen and spores, the specialist distinguishes a wide variety of other microfossils, ranging from soil fungi to single-celled endoparasites. These microfossils, including pollen and spores, are called palynomorphs. Palynology is the science that deals with these particles. In addition to the group of microfossils taken with palynological research, diatoms (diatoms) are valuable for archaeological research in a number of cases. Diatoms can be determined on the basis of lime skeletons. Pollen and spores are also present everywhere and in abundance today: in the air, in water, on and in the ground. Pollen and spores are found in archaeological context mainly in an uncharred form. The material is preserved under low-oxygen conditions in permanently wet environments. In addition, pollen is preserved under special conditions, for example, in mineralized manure (coprolites) and microenvironments in which pollen remains preserved occur, particularly in dry, acidic soils. Translated into sediments, these remains are best preserved in peat, lake deposits (gyttja) and clay. In sandy soils, pollen is preserved only in soils. In archaeological contexts, pollen and traces are found particularly in all kinds of soil traces that extend below the permanent level of the groundwater, such as ditches, wells, pits, humus packages and field layers. This category of material is also preserved in, for example, ash decks - located above the groundwater table. 18 18 19 -== Onderzoek==19 +== Research == 20 20 21 - Glasbiedt veel onderzoeksmogelijkheden op sociaaleconomisch gebied, waaronder de reconstructie van handelsroutes en – betrekkingen en technologische ontwikkelingen in het verleden. De hoge status die glaswerk in veelperiodesgenoot, resulteerde in modegevoelige producten waardoor de verschillendemodellenelkaar snel opvolgden. Glazen voorwerpen hebbent vanwege de fragiliteit doorgaans een relatief korte levensduur. Glazen objecten zijn daaromzeer geschikt voor het vaststellenvan de dateringvan archeologische complexen. Bij het glasonderzoek worden kwalitatieve (zoals bijvoorbeeld kleur, hoedanigheid en functie van het voorwerp) en kwantitatieve eigenschappen (zoals aantal scherven, gewicht, fragmentatiegraad, en minimum aantal exemplaren) vastgesteld. Bij voorwerpen en, in mindere mate, scherven kan door middel van typo-chronologie de relatieve datering worden bepaald.21 +=== Landscape and environment === 22 22 23 +Palynological research is eminently applicable for obtaining information about landscape and environment and their developments over time. It is recommended that palynological research be combined with physical geographic and soil research, so that a precise layout of the landscape in certain successive periods is possible. The sample locations for landscape and environmental research are preferably outside the settlement and thus often outside the excavation. Undisturbed soils and sediments are prerequisites for good results. 23 23 24 -= Metaal =25 +=== Agriculture === 25 25 26 - ==Aard en voorkomen==27 +An example for this research topic is palynological research on ash decks. This research provides information about the crops grown and the organic fertilizers applied. Ash decks are generally well above groundwater. Yet the soil conditions are such that the pollen is preserved. Pollen and traces of the plants that once stood in the field may also have been preserved in honorary loft traces. However, the preservation conditions here are less favorable and the likelihood that the pollen has been preserved is greatest in places where the fields were in a moist environment; for example, plow marks on peat that have been covered by sand or plow marks on sand that have been covered by peat or clay. Coprolites and (mineralized) manure from cattle, goats, sheep, for example, contain a lot of pollen. Analysis of these remains provides information about the food of these animals and/or the pastures where they walked. 27 27 28 - Metaalwordtondertoevoeging vanenergie uitdelfstoffenverkregen. Als gevolg hiervan is het een in wezen instabiele materiaalgroep die geneigd is om weer tot de oorspronkelijke toestand, die van erts, te vergaan. Als gevolg van (elektro)chemische processen zijn metalen in de bodem onderhevig aan corrosie. De aard en mate van corrosie is afhankelijk van een groot aantal variabelen in de bodemgesteldheid en in de eigenschappen van het metaal. De belangrijkste variabelen in de bodem zijn: de zuurgraad en hetvochtgehalte van de bodem, de hoeveelheid en aard van de aanwezige ionen, de doorlaatbaarheid van de bodem en daarmee de snelheid van uitwisseling van ionen en gassen. Wat het object betreftzijn de homogeniteit van de samenstelling, deoppervlakteruwheid enhet oxidatiepotentiaalvanhetmetaal de belangrijkstefactoren. Het snelste verval vind plaats in een relatief droge, zandige en goed doorlatende bodem. Metaal blijft het best behouden in een bodem die nat, compact en rijk aan organische bestanddelen is. In deze omgevingstypen ontstaan respectievelijk aërobe en anaërobe corrosiepatronen. Voor metaal van de zeebodem geldt in grote lijnen hetzelfde als voor vondsten van het land. Materiaal dat zich onder water onder lagen organisch materiaal bevindt, zal een corrosiepatroon vertonen dat vergelijkbaar is met dat van een anaërobe omgeving, met dien verstande dat de maritieme omgeving door het hoge zoutgehalte (chloor) een meer agressieve corrosie te zien geeft. Van metaal zijn in de oudheid tal van producten vervaardigd. Bij archeologisch onderzoek kunnen metalen objecten als verloren object, afval, productierestant of in de vorm van bijgaven in begravingen aangetroffen worden.29 +=== Food- and utilization plants === 29 29 30 - ===**IJzer**===31 +The examination of botanical macro remains (seeds, fruits, etc.) is ideally suited to obtain information on food and use plants. Palynological research can provide additional information, especially about plants from which no seeds or fruits were eaten, but leaves, for example. Increasingly, this facet of pollen research is being conducted as part of archaeobotanical research. Since pollen is only preserved in its uncharred form, archaeological traces that have been in permanent contact with groundwater, such as fills of cesspools, wells and deep pits, are particularly eligible. 31 31 32 - Ineen zuurstofrijke omgeving vormtzich op ijzer een dikke laag corrosie inde vorm vanijzerhydroxide. Het object wordt in een relatief hoog tempo in corrosiemateriaalomgezet. Nahet opgraven kan door een wisselwerking met atmosferisch vocht en in deze laag aanwezige chlorideioneneen kristalomzetting plaatsvinden. Doordat de gehele corrosielaag van de ijzeren kern afschilfert, wordt aan het object grote schade toegebracht. Aërobe corrosiela-gen zijn herkenbaar aan het grote volume en de bruine kleur. Door een tijdige conserveringsbehandeling kan het corrosiemateriaalop het object over het algemeen redelijk behouden worden. - IJzer uit een anaërobe omgeving vertoont een dunnere corrosie die zwart van kleur is door de daarin voorkomende sulfiden en oxiden. Het gevaar van afschilferen is hier minder aanwezig. Doorgaans is nog een goed gedetailleerd ijzeren object onder de corrosielaag aanwezig. - Bij gietijzer vormt zich in nagenoeg elke bodem corrosie tussen de kristallen van het materiaal. Gietijzer is daardoor niet gemakkelijk te stabiliseren.33 += Botanical macro remains = 33 33 34 -== =**Koperlegeringen**===35 +== Nature and occurrence == 35 35 36 - Koper wordtmeestalalsbrons(gelegeerd met tin) ofmessing(gelegeerd metzink) aangetroffen, maar ook objectenvan zuiver koper komen voor.37 +Botanical macro remains are defined as: 37 37 38 -* In een goed beluchte bodem ontstaat aan koperlegeringen een weinig stabiel corrosiepatroon, vooral als er veel chloor in de bodem aanwezig is. Meestal bestaat de corrosie uit een egale donkergroene laag van carbonaten die hier en daar doorbroken wordt door licht blauwgroene puisten waar koperchloride te zien is: putcorrosie. Bij onoordeelkundige conservering en deponering kan bij dit materiaal later de zogenaamde bronspest ontstaan. 39 -* In een anaërobe omgeving ontstaan op koperlegeringen voornamelijk corrosieproducten die in water oplosbaar zijn. Hierdoor wordt het object als blank metaal gevonden. Deze vorm van verval wordt ook wel moor-patina genoemd. Uiteindelijk kan het object geheel in de bodem oplossen. 39 +* various parts of plants, such as seeds, fruits, stems, threshing residues, roots, tubers; 40 +* Remains composed of plants, such as food remains (bread, porridge), caking in pots; 41 +* imprints, particularly in pottery and hut clay. These are usually small remains (0.25 - 5 mm), which are hardly visible to the naked eye. 40 40 41 - ===**Lood en tin**===43 +Not only the size of the remains, but also the fact that they are surrounded by soil, means that they are usually not seen during fieldwork. Only a concentration of botanical material or remains larger than 5 mm, for example cherry pits or shell parts of hazelnuts, are recognizable in the field. Because these botanical macro remains are generally so small, it is common to take soil samples. A wide range of plant remains can be found in soil samples. Seeds, fruits, and charcoal are the most common plant remains. The possibilities for charcoal research are discussed elsewhere. In addition to the seeds and fruits already mentioned, plant remains that cannot be identified at first glance are regularly found in soil samples. These may be plant fibers, (charred) food remains or remains of roots and tubers. With the aid of a microscope (sometimes an electron microscope is needed) these remains can usually be identified. Also in caked layers in pots or tubs recognizable plant remains may be present, which may give insight into the origin of the caking (food or some craft process). Especially in pottery and hut loam impressions of plant remains can be easily recognized. The plant remains themselves have often disappeared. The impressions generally contain sufficient features for determination. For this component, consultation between the pottery specialist and the botanical specialist is recommended. Botanical macro remains occur in charred, uncharred, or mineralized form. In archaeological contexts, plant remains may be charred only under the influence of fire. In charred form, the material can be preserved in all types of archaeological traces. Charred remains, however, are fragile. The temperature at which the remains carbonized as well as various (post)depositional processes influence the quality of the carbonized material. In uncharred form the remains will be preserved especially under extremely dry or under oxygen-poor, wet conditions. In archaeological context (in the Netherlands) we are almost exclusively dealing with the second situation. This means that in archaeological traces that have been permanently under the influence of groundwater, uncharred plant remains may occur, for example in wells, cesspools, pits, embankments. The quality of the uncharred material is good when the tracks in which they ended up have been wet from the beginning of deposition. A poorer preservation is always related to the drying of the soil in which the remains were found. Plant remains mineralize when they come into contact with phosphates. The mineralization process preserves plant remains even in dry environments. The quality of mineralized remains is generally moderate to poor. In archaeobotanical research these remains play, with a few exceptions, a subordinate role. Occasionally, plant remains are preserved in the vicinity of metal. 42 42 43 - Looden tin zijn redelijk bestandtegen bodeminvloeden.45 +== Research == 44 44 45 -* In een aërobe omgeving ontwikkelt zich op beide metalen een laag grijze corrosie die voornamelijk uit carbonaten bestaat. 46 -* In een anaërobe omgeving ontstaat een zeer dunne laag van zwarte sulfiden. Lood en tin komen vaak met elkaar in legering voor. 47 +Research on botanical macro remains provides valuable contributions about: 47 47 48 -Tin kan door tinpest aangetast worden. Bij dit nog niet geheel begrepen vervalpatroon wordt het metallische tin omgezet in een lossere kristalstructuur die weinig samenhang heeft. Tinpest ontstaat alleen bij temperaturen beneden 13 graden Celsius, doch waarnemingen van ontstaan ervan bij temperaturen beneden het vriespunt zijn niet bekend. Waarnemingen van het ontstaan van tinpest in de bodem zijn zeer zeldzaam. 49 +* food and use plants 50 +* agriculture (arable and livestock farming) 51 +* landscape and environment 52 +* trade and industry 49 49 50 - ===**Zilver**===54 +In addition, seeds and fruits in particular are ideally suited for 14C research because - unlike wood - this material was formed in a very short time, usually within one year. 51 51 52 - Hoewelzilver een tamelijk edel metaal is, verdraagt het een verblijf in de bodemslechterdan bijvoorbeeld lood of tin.56 += Glass = 53 53 54 -* In een luchtige bodem ontstaat een grijze laag zilverchloride. Dit materiaal is lichtgevoelig en verkleurt daardoor in korte tijd naar paars. Niet zelden is het object sterk aangetast. 55 -* In een anaërobe bodem vormt zich op zilver een laag sulfide die relatief eenvoudig te verwijderen is en waaronder zich meestal nog een weinig aangetast object bevindt. 58 +== Nature == 56 56 57 - Zilver wordtvaakmetkoper gelegeerd waardooreenzilveren object met eengroenekoperoxide overdektkanzijn en daardoor aanvankelijkabusievelijk voorkoper aangezienwordt.60 +Glass is created when a mixture of silicon with potassium or sodium or lead, and calcium is exposed to a high temperature. At about 1000 degrees Celsius in an open fire, a glassy crystallized substance, opaque but with a dense structure that, after grinding, is solidified by heat: faience. It is found mainly in the form of beads. They can vary in quality from solid to friable. In closed kilns with a higher temperature at which glass melts (<1200 degrees Celsius), it occurs both transparent and opaque (opaque), depending on the addition of coloring metal oxides and firing atmosphere. Glass is encountered in many different qualities in the soil. Often it was broken in the old days and dumped as waste. Glass (even the highest quality glass) has been fragmented by mechanical (pressure) force. Glass is sensitive to moisture. Glassware from Roman-early medieval graves can be found intact in many cases. Late and post-medieval utility glass is often of poor quality, making it extra sensitive to moisture. Impure composition of the (lower quality) raw materials, too short firing time of the mixture and/or too low firing temperature are to blame. The composition of the soil also affects the quality and conservation of the glass. 58 58 59 -== =**Goud**===62 +== Research == 60 60 61 -G oudwordtdooreenverblijfindebodemnietaangetast. Bij eenlaaggoudgehaltekanoorandereelegeringanwezigecomponentenweleencorrosielaagontstaan. Op goudvormtzichvaakeenbruineneerslagvan ijzerzouten,die goedte verwijderenis.Metaalwordtdikwijlsinsamenhangmetanderematerialenaangetroffen,watvoorverderebehandeling eencomplicerendefactoris.In voorkomendegevallenlaatmen de behandeling vanhetestkwetsbaremateriaalprevaleren.Opmetalenobjectenwordengeregeldgemineraliseerde restantenvanvergane organischematerialenwaargenomen,bijvoorbeeldvanhout, textielofleer.Omdatmateriaalzeerinformatiefis,moethiermeezeervoorzichtig wordenmgesprongen.64 +Glass offers many research opportunities in the socio-economic field, including the reconstruction of trade routes and relations and technological developments in the past. The high status that glassware enjoyed in many periods resulted in fashionable products, so that the various models succeeded each other rapidly. Glass objects generally have a relatively short lifespan due to their fragility. Glass objects are therefore very suitable for determining the dating of archaeological complexes. The glass examination determines qualitative (e.g. color, quality and function of the object) and quantitative characteristics (e.g. number of shards, weight, degree of fragmentation, and minimum number of specimens). For objects and, to a lesser extent, shards, relative dating can be determined by typo-chronology. 62 62 63 -= =Onderzoek==66 += Metal = 64 64 65 - Metaalis in de oudheid een materiaal dat moeilijk te winnen en daardoor kostbaar was. In een cultuurwordenvan metaal dikwijls objecten vervaardigd die karakteristiek zijn voor beroepsuitoefening, huishouden en rituelen. Eenmaal opgegraven kunnen zij veel informatie verschaffen over vroegere maatschappelijke structuren. Ook geven zij inzicht in de ontwikkeling van de (vervaardigings-)techniek. Vaak zijn deze objecten aan een duidelijke vormontwikkeling onderhevig wat een gebruik als dateringsmateriaal mogelijk maakt. Vooral munten vormen een betrouwbare en relatief eenvoudig te raadplegen dateringsbron. Omdat metalen objecten in grote aantallen bij opgravingen aangetroffen worden, dient eerst een selectie toegepast te worden. Hierbij wordt voor elk object bepaald of het voldoende informatie geeft om een individuele gang door het onderzoekstraject te rechtvaardigen. Dit houdt in dat het object bij het onderzoek beschreven en afgebeeld zal worden en dat het naderhand ter verificatie op te sporen moet zijn. Een dergelijk object van hoge informatiewaarde krijgt daarom een uniek vondstnummer en wordt, indien mogelijk, geconserveerd. Objecten van een lagere informatiewaarde worden bij verder onderzoek niet individueel behandeld, maar hooguit per spoor als groep beschreven, gewogen of gemeten. De selectie van het materiaal wordt gemaakt door de veldarcheoloog, in samenwerking met de materiaalspecialist en bij voorkeur ook met de conserveringsdeskundige. De bij onderzoek verzamelde informatie vormt het uitgangspunt voor de maatschappelijke en economische duiding van een context of vindplaats. Met betrekking tot de materiaalcategorie ‘metaal’ kunnen voorts een aantal specifieke onderzoekstechnieken worden genoemd:68 +== Nature == 66 66 67 -* Röntgenonderzoek. Individueel te behandelen objecten kunnen, als reinigen en conserveren niet mogelijk is, met behulp van röntgen onderzocht en afgebeeld worden. 68 -* Microscopie. Met optische of elektronenmicroscoop wordt het oppervlak bestudeerd om informatie te verzamelen over bewerkings- en gebruikssporen en over gemineraliseerde organische resten. 69 -* Metaalkundige analyse. Een polijstplaatje van een monster van het object wordt microscopisch bestudeerd. Vervaardigingstechniek, bewerking en corrosie laten karakteristieke sporen na. 70 -* Röntgenfluorescentie en andere element-analysetechnieken. Van een metaalmonster wordt de materiaalsamenstelling bepaald. Hierin kunnen aanwijzingen voor materiaalgebruik en bewerkingstechniek worden gevonden 71 -* Röntgendiffractie. Door de kristalstructuur te bepalen kan informatie over corrosieprocessen verkregen worden. 72 -* Massa-spectrometrie. De verhouding van de verschillende isotopen van een metaal wordt vastgesteld. Hiermee kan in sommige gevallen de herkomst van het materiaal worden bepaald. 70 +Metal is obtained from minerals under the addition of energy. As a result, it is an essentially unstable group of materials that is prone to decay back to its original state, that of ore. As a result of (electro)chemical processes, metals in the soil are subject to corrosion. The nature and extent of corrosion depends on a large number of variables in soil conditions and in the properties of the metal. The most important variables in the soil are: the acidity and moisture content of the soil, the amount and nature of ions present, the permeability of the soil and thus the rate of exchange of ions and gases. As for the object, the homogeneity of its composition, the surface roughness and the oxidation potential of the metal are the most important factors. The fastest decay occurs in a relatively dry, sandy and well permeable soil. Metal is best retained in a soil that is wet, compact and rich in organic constituents. In these environment types, aerobic and anaerobic corrosion patterns occur, respectively. For metal from the seafloor, the same is largely true as for finds from the land. Material located underwater beneath layers of organic material will exhibit corrosion patterns similar to those of an anaerobic environment, except that the maritime environment will exhibit more aggressive corrosion due to the high salt content (chlorine). Many products were made of metal in ancient times. During archaeological research, metal objects may be found as lost objects, waste, production residues, or in the form of burial gifts. 73 73 74 - Voorafgaandaan microscopisch onderzoekmag het te bestuderen materiaal niet geïmpregneerd worden. Bij de overige analytische onderzoekstechnieken worden aan de behandeling van de vondsten geen eisen gesteld, omdat ze uitgaan van een monster aan de binnenzijde van het materiaal.72 +=== **Iron** === 75 75 76 - =Natuursteen=74 +In an oxygen-rich environment, a thick layer of corrosion in the form of iron hydroxide forms on iron. The object is converted into corrosion material at a relatively high rate. After excavation, crystal conversion can occur through interaction with atmospheric moisture and chloride ions present in this layer. As the entire corrosion layer flakes off the iron core, great damage is done to the object. Aerobic corrosion can be recognized by its large volume and brown color. With timely conservation treatment, the corrosion material on the object can generally be reasonably preserved. - Iron from an anaerobic environment exhibits a thinner corrosion that is black in color due to the sulfides and oxides present in it. The danger of flaking is less present here. Usually a well detailed iron object is still present under the corrosion layer. - In cast iron, corrosion forms between the crystals of the material in almost every soil. Cast iron is therefore not easy to stabilize. 77 77 78 -== Aardeen voorkomen==76 +=== **Cupperalloy** === 79 79 80 - In de archeologiewordtdeterm natuursteen gebruiktom onderscheidaantebrengentussen steen en steenachtige materialendiekunstmatig, door de mens gemaaktzijn,zoals aardewerken slakken. Steen iseenalgemene naam voor gesteente(“rots”),dat als afzonderlijke stukken,al dan nietbekapt of verbrijzeld in archeologischecontext kan worden aangetroffen.Gesteenten zijn in de natuurvoorkomendeaggregaten van éénof meermineralen. Ze kunnen grofwegin drie hoofdgroepen ingedeeld worden:78 +Copper is usually found as bronze (alloyed with tin) or brass (alloyed with zinc), but objects of pure copper also occur. 81 81 82 -1. Magmatische gesteenten: ontstaan door stolling van magma, dat is vloeibaar gesteentemateriaal. Voorbeelden: graniet, bazalt, tefriet. 83 -1. Sedimentaire gesteenten: door verschillende processen (verwering, erosie, afzetting en eventueel verkitting) aan ( of dicht onder) het aardoppervlak gevormd. Voorbeelden: zandsteen, siltsteen, kalksteen, vuursteen, maar ook losse gesteenten als klei en zand horen hiertoe. 84 -1. Metamorfe gesteenten: gesteenten die bij verhoogde temperatuur (en vaak ook verhoogde druk) een verandering hebben ondergaan in structuur en/of mineralogische samenstelling. Voorbeelden: leisteen, marmer, kwartsiet. 80 +* In well-aerated soils, copper alloys develop an unstable corrosion pattern, especially if there is a lot of chlorine in the soil. Usually the corrosion consists of an even dark green layer of carbonates that is broken here and there by light blue-green pustules where copper chloride can be seen: pitting corrosion. With improper preservation and deposition this material can later develop the so-called bronze plague. 81 +* In an anaerobic environment, mainly water-soluble corrosion products are formed on copper alloys. As a result, the object is found as bare metal. This form of decay is also called moor-patina. Eventually, the object may dissolve completely in the soil. 85 85 86 - Archeologenspreken vaak van natuursteen en vuursteen, alsof het twee naast elkaar staande,verschillende categorieënbetreft. Dit is nomenclatorisch onjuist (vgl. “dierenen koeien”). Daar vuursteeninde Steentijd de belangrijkste grondstof was, is er een eigen specialisme ontstaan, waarbij de aandacht voor andere steensoorten is veronachtzaamd. In deze specialismen is veel kennis ontwikkeld omtrent typologie, productietechnieken en gebruikssporen, die ook van nut zouden kunnen zijn voor voorwerpen van andere steensoorten die in de Steentijd zijn gebruikt. Het verdient dan ook aanbeveling dat de vuursteenspecialist zijn kennis naar deze steensoorten uitbreidt, of dat deze specialist zeer nauw samenwerkt met de specialist voor de andere steensoorten. Om die reden wordt voor de behandelwijze van het vroege steenmateriaal verwezen naar het hoofdstuk over vuursteen. Gesteenten zijn in het verleden gebruikt voor de productie van diverse soorten gereedschap (slijpstenen, maalstenen, vijzels, gewichten, etc.) bouw- en beeldhouwwerk, waaronder sarcofagen. Gesteenten zijn ook gewonnen voor de productie van aardewerk, glas en metalen (ook ertsen zijn gesteenten!). Verder zijn de organogene sedimenten van belang, zoals steenkool, barnsteen, koraal en git. Ook sierstenen kunnen worden aangetroffen, zoals edelstenen (topaas), halfedelstenen (granaat/almandien en diverse kwartsvarianten, etc.). In ons land worden veel stenen als zwerf-/rolsteen gevonden, terwijl andere in groeves zijn gewonnen uit vast gesteente83 +=== **Lead and tin** === 87 87 88 - ==Onderzoek==85 +Lead and tin are reasonably resistant to soil impacts. 89 89 90 -Natuursteen komt voor op nagenoeg alle archeologische vindplaatsen, vanaf het Paleolithicum tot de Moderne Tijd en het is verbazingwekkend dat het, met uitzondering van vuursteen, een stiefmoederlijk behandelde vondstcategorie is, die lang niet altijd gedetermineerd wordt en soms maar ten dele verzameld wordt. De afwezigheid van vast gesteente in Nederland maakt juist dat deze vondstcategorie zo rijk aan informatie is. Naast de typologie van bepaalde voorwerpen, geeft het inzicht in op de site verrichte ambachten, in activiteitsgebieden en de intensiteit daarvan, denk aan malen, vissen, slijpen (metaalbewerking). Het geeft ook inzicht in de technologie van de gereedschapsproductie. Vanaf de Romeinse tijd draagt het natuursteenonderzoek bij aan de kennis van bouwmaterialen en -technieken. Herkomstbepalingen van steen draagt bij aan de kennis over handelscontacten en netwerken. In sommige gevallen kan ook natuursteen bijdragen aan de datering van de vindplaats, dit geldt vooral voor Romeins en (Vroeg-) Middeleeuws materiaal. Het reguliere onderzoek omvat de macroscopische determinatie van de steensoort en het object wat er van gemaakt is. Dit omvat kwalitatieve eigenschappen (kleur, vorm, steensoort, bewerking-/gebruiksspoor, type van artefact, typo-chronologie, postdepositionele sporen) en kwantitatieve eigenschappen (formaat, aantal, gewicht en fragmentatiegraad). Specifiek onderzoek wordt gebruikt om bovengenoemde kwalitatieve eigenschappen te kwantificeren, zoals het meer inzicht krijgen in steensoorten en hun herkomstgebieden; aard van gebruiks-/productiesporen; conserveringstoestand en degradatie processen van de verschillende steensoorten in verschillende bodemmilieus. De volgende technieken worden algemeen gebruikt: 87 +* In an aerobic environment, a layer of gray corrosion consisting mainly of carbonates develops on both metals. 88 +* In an anaerobic environment a very thin layer of black sulfides develops. Lead and tin often occur in alloy with each other. 91 91 92 -* microscopische analyses (doorvallend/opvallend licht); 93 -* röntgendiffracometrie (XRD), voor het mineralogisch onderzoek. 94 -* microprobe en scanning electron microscope (SEM) voor in situ analyses in een voorwerp. 90 +Tin can be affected by tin plague. In this not yet fully understood decay pattern, the metallic tin is converted into a looser crystal structure that has little cohesion. Tinning plague only occurs at temperatures below 13 degrees Celsius, but observations of its occurrence at temperatures below freezing are unknown. Observations of the occurrence of plague in soil are very rare. 95 95 96 - Verderbestaan er fysisch-chemische analysemethoden, zoals neutronenactiveringsanalyse(NAA), röntgenfluorescentie (XRF), infraroodspectrometrie (IR) en vele andere om de samenstelling (hoofd- en/of sporenelementen) te bepalen. In enkele gevallen kan het zinvol om fysische eigenschappen zoals soortelijke gewicht of breeksterkte te bepalen.92 +=== **Silver** === 97 97 98 - =Onverbrandbot/verbrandbot=94 +Although silver is a fairly noble metal, it tolerates a stay in the soil worse than, say, lead or tin. 99 99 100 -== Aard en voorkomen dierlijk == 96 +* In airy soil a gray layer of silver chloride forms. This material is sensitive to light and therefore discolors to purple in a short time. Not infrequently the object is strongly corroded. 97 +* In an anaerobic soil a layer of sulphide forms on silver that is relatively easy to remove and under which there is usually still a little tarnished object. 101 101 102 - Dierlijkeestenkunnen alslosse skeletelementen offragmentendaarvan gevonden worden(slacht-,consumptie enproductieafval), maar ookinanatomischverbandworden aangetroffenen deel uitmakenvaneenmeer of mindercompleet skelet. Het dierkan zijn geofferdof anderszins bewustzijn begraven,of een natuurlijke dood zijngestorven. Deskeletelementenkunnen onbeschadigd zijn, maarook vraat-, snij-, kap- of andere bewerkingssporen vertonen.Dierlijkerestenkunnen ook wordengebruiktvoorhet maken van voorwerpen (artefacten)of deeluitmakenvan een, uitmeerdere materialen samengesteld,voorwerp (bijvoorbeeldbenen heftvaneenijzerenmes).99 +Silver is often alloyed with copper so a silver object may be covered with a green copper oxide and therefore initially be mistaken for copper. 103 103 104 -== Onderzoek dierlijk==101 +=== **Gold** === 105 105 106 - Het belangvandierlijk materiaalkan voordearcheologiemoeilijkonderschatworden.Devondstgroepkanonder andereenbijdrage leverenaandereconstructie vanhetlandschap,aan dekennisvandeontwikkelingen gezondheidstoestandvan(huis)diereninhet verledenen aanhetduidenvantalrijke sociaal-economische enreligieuzeaspectenvanvroegeresamenlevingen.Daarbij kanbijvoorbeeldwordengedachtaandevoedseleconomie(of er sprakes van, enzoja,dewijzewaaropjachtnveeteeltwerdenbedreven),aanderelatietussenvleesconsumptieensocialestatusenaanambachtelijkeproductieprocessen.103 +Gold is not affected by staying in the soil. However, if the gold content is low, other components present in the alloy can cause a corrosion layer to form. A brown precipitate of iron salts often forms on gold, which is easy to remove. Metal is often found in association with other materials, which complicates further treatment. If necessary, the treatment of the most vulnerable material is given priority. Mineralized remnants of decayed organic materials, e.g. wood, textile or leather, are regularly observed on metal objects. As material is very informative, this should be handled with great care. 107 107 108 - Bijhet archeozoölogisch onderzoek worden kwalitatieve (zoals bijvoorbeeld diersoort, skeletonderdeel, gebitsslijtage) en kwantitatieve eigenschappen(zoals aantal, gewicht, fragmentatiegraad) vastgesteld. Deze basisgegevens vormen het uitgangspunt voor het archeozoölogisch onderzoek van een context of vindplaats. Voorwerpen kunnen soms typochronologisch worden gedateerd. Er bestaan enkele specifiek(e) onderzoeksvormen en -technieken:105 +== Research == 109 109 110 -* datering: de absolute ouderdom van botmateriaal (verbrand en onverbrand) kan door middel van 14C datering worden vastgesteld; 111 -* DNA-onderzoek; 112 -* Chemische analyse; 113 -* Histologisch onderzoek: aan kleine monsters is via dit onderzoek het verschil tussen mens en dier, evenals de diersoort, vast te stellen. Tevens kan de conserveringstoestand van het bot worden vastgesteld; 114 -* Micro-wear analyse 107 +In ancient times, metal was a material that was difficult to extract and therefore expensive. In a culture, objects are often made of metal that are characteristic of occupations, households and rituals. Once excavated, they can provide a lot of information about past social structures. They also provide insight into the development of the (manufacturing) technique. Often these objects are subject to a clear development of form, which makes their use as dating material possible. Coins in particular are a reliable and relatively easy to consult dating source. Because metal objects are found in large numbers in excavations, a selection must first be made. For each object it is determined whether it provides enough information to justify an individual course of research. This means that the object will be described and depicted during the research and that it must be possible to trace it afterwards for verification. Objects of high informational value are therefore given a unique find number and, if possible, preserved. Objects with a lower information value will not be treated individually during further research, but at most described, weighed or measured per trace as a group. The selection of the material is made by the field archaeologist, in collaboration with the material specialist and preferably also with the preservation expert. The information gathered during research forms the starting point for the social and economic interpretation of a context or site. A number of specific investigation techniques can also be mentioned with regard to the material category 'metal': 115 115 116 -evenals de diersoort, vast te stellen. Tevens kan de conserveringstoestand van het bot worden vastgesteld; 109 +* X-ray examination. If cleaning and preservation are not possible, individual objects can be examined and depicted using X-rays. 110 +* Microscopy. With optical or electron microscope, the surface is studied to gather information on processing and use traces and on mineralized organic residues. 111 +* Metallic analysis. A polishing plate from a sample of the object is studied microscopically. Manufacturing technique, machining and corrosion leave characteristic traces. 112 +* X-ray fluorescence and other elemental analysis techniques. The material composition of a metal sample is determined. Indications for material use and processing technique can be found here 113 +* X-ray diffraction. By determining the crystal structure, information about corrosion processes can be obtained. 114 +* Mass spectrometry. The ratio of the different isotopes of a metal is determined. This can be used to determine the origin of the material in some cases. 117 117 118 - ==Aard envoorkomen menselijk==116 +Prior to microscopic examination, the material to be studied may not be impregnated. The other analytical research techniques do not impose any requirements on the handling of the finds, because they assume a sample from the inside of the material. 119 119 120 - Menselijkskeletmateriaal kan in verschillende vormen worden aangetroffen. In inhumatiegraven ligt het skelet meestal in anatomisch verband in een graf. De houding in het graf kan sterk variëren. We maken onderscheid tussen primaire en secundaire inhumatiegraven. Primaire inhumatiegraven zijn graven waarin het intacte skelet wordt aangetroffen, zoals het werd gedeponeerd na het overlijden. Secundaire inhumatiegraven worden gekenmerkt doordat er sprake is van een behandeling van het lichaam na het overlijden en voor de bijzetting. In het geval van een secundaire begraving liggen de delen van het skelet doorgaans niet meer in anatomisch verband. Behalve inhumatiegraven komen ook crematiegraven voor.Nalijkverbranding kunnen de crematieresten op de brandplaats zijn achtergelaten ofwel in eenurn of los in een kuil zijn bijgezet. Nietallemenselijke skeletresten wordenaangetroffenin de context van een opzettelijke begraving. Lichamen kunnen zijn achtergelaten of achtergebleven zonder formeel te zijn begraven. Bovendien kunnen skeletelementen na deponeren in de bodem uit hun context zijn geraakt door diverse processen en activiteiten. Dergelijke skeletten zijn vaak incompleet en de teruggevonden delen kunnen vraatsporen, snijsporen, botbreuken en sporen van secundaire verbranding vertonen.118 += Natural stone = 121 121 122 -== Onderzoekmenselijk==120 +== Nature == 123 123 124 - Uit het skelet kunnengegevens over geslacht, leeftijd, lichaamslengte en pathologieafgeleid worden. Daardoor geefttskeletmateriaalinformatieoverde demografieengezondheid vanvroegere populaties.Relaties metde voedseleconomieenlevenswijze zijndaarbijvan belang. Insamenhangmetdearcheologische context, zoalsgraftypeen bijgaven, wordentraditiesin de behandeling van de dode belicht.Gegevensaangaandegeslachten leeftijd zijn vanbelang voor hetonderzoekvanesocialeen cultureleaspectenvanhetgrafritueelbinnen een populatieen/oftussen verschillenden populaties inruimteen tijd. Het onderzoekvan menselijkeskeletelementenis een onderdeel van de fysischeantropologie.Hetfysisch antropologisch onderzoekomvatdeinventarisatievandeaanwezige skeletdelen,de bepaling van het geslachten deschattingvan leeftijd en lengte. Verderwordenbotmaten, niet-metrischevariatie eneventuele pathologische veranderingeninhetskeletgedocumenteerd.De beschrijvingvan crematierestenomvateveneensgegevensoverhetgewicht, de fragmentatie endeverbrandingsgraad.Skeletmateriaalkanookbenutwordenvoor specifiekonderzoek:122 +In archaeology, the term natural stone is used to distinguish between stone and stony materials that are artificial, man-made, such as pottery and slag. Stone is a general name for rock ("rock"), which may be found as individual pieces, either cut or crushed, in archaeological contexts. Rocks are naturally occurring aggregates of one or more minerals. They can be broadly classified into three main groups: 125 125 126 -* 14C-datering: voor de bepaling van de absolute ouderdom van botmateriaal (verbrand en onverbrand); indien AMS meteen ook isotopen onderzoek koolstof en stikstof isotopen! * DNA-onderzoek: voor de bepaling van genetische verwantschap en pathologisch onderzoek (monstername door of in overleg met specialist). 127 -* Chemische analyse: onderzoek van stabiele isotopen en sporenelementen voor de bepaling van paleodieet, toxische belasting en herkomst (monsters voor biochemisch onderzoek afspreken met specialist). 128 -* Entomologisch onderzoek: voor de studie van insecten uit de grafcontext (monstername door specialist). 129 -* Microscopisch onderzoek: door middel van histologisch onderzoek is het eveneens mogelijk de biologische leeftijd van een individu te bepalen. Hierbij wordt gebruik gemaakt van de pijpbeenderen en de gebitselementen. Verder kan histologisch onderzoek toegepast worden om pathologische veranderingen in het skelet nader te onderzoeken (monsters hoeven niet in veld genomen te worden). 130 -* Palynologisch onderzoek: regionale/lokale herkomst individu, bijvoorbeeld van bloemenbijgave in grafkuil (monstername door specialist). 131 -* Röntgenologisch onderzoek: ter bepaling van de leeftijd bij overlijden en diagnose van pathologische veranderingen in het skelet. * Aangezichtsreconstructie: om aan de hand van de schedel het aangezicht van personen uit het verleden te reconstrueren. 124 +1. Magmatic rocks: formed by solidification of magma, which is liquid rock material. Examples: granite, bazalt, tephrite. 125 +1. Sedimentary rocks: formed by various processes (weathering, erosion, deposition and possibly charring) at (or close to) the earth's surface. Examples: sandstone, siltstone, limestone, flint, but also loose rocks such as clay and sand belong to this category. 126 +1. Metamorphic rocks: rocks that have undergone a change in structure and/or mineralogical composition at increased temperature (and often also increased pressure). Examples: slate, marble, quartzite. 132 132 133 - =Slakken/sintels=128 +Archaeologists often refer to natural stone and flint as if they were two adjacent, distinct categories. This is nomenclaturally incorrect (cf. "animals and cows"). Since flint was the most important raw material in the Stone Age, a specialism of its own has developed, neglecting attention to other stone types. In these specialties much knowledge has been developed about typology, production techniques and traces of use, which could also be useful for objects made of other stone types used in the Stone Age. It is therefore recommended that the flint specialist extends his knowledge to these types of stone, or that he works very closely with the specialist for the other types of stone. For this reason, reference is made to the chapter on flint for the treatment of early stone material. Rocks have been used in the past for the production of various types of tools (grindstones, grinding stones, mortars, weights, etc.) building and sculpture, including sarcophagi. Rocks have also been mined for the production of pottery, glass and metals (ores are also rocks!). Also of interest are organogenic sediments, such as coal, amber, coral, and git. Ornamental stones may also be found, such as precious stones (topaz), semi-precious stones (garnet/almandine and various quartz varieties, etc.). In our country, many stones are found as boulders/rolling stones, while others are quarried from solid rock 134 134 135 -== Aarden voorkomen==130 +== Research == 136 136 137 - Dithoofdstukbehandeltde restenvan pyrotechnischeprocessen,ofteweldeafvalproductendievrijkomenbij blootstellingvan materiaal aanvuur.Bijde eersteselectie inhetveldkomen devolgendematerialenvaakinde categorieslakterecht:ijzerslak, ijzererts,gebrandeleemengesinterd materiaal.Eenslakis eenafvalproductvan metaalproductie,-verwerking,ennonmetallurgischeprocessen,zoalskalkbranden,baksteenproductie, aardewerkproductie englasproductie en-verwerking.Geziende resistentie tegen secundaire degradatiezalhetmateriaaln vrijwelelke sitevanafdeBronstijdvoorkomen.Een uitzonderingisgebrandeleem,dat namelijkzeer fragielkanzijn.132 +Natural stone occurs at virtually all archaeological sites, from the Paleolithic to the Modern Period and it is surprising that, with the exception of flint, it is a stepmotherly find category, by no means always determined and sometimes only partially collected. The absence of solid rock in the Netherlands is precisely why this find category is so rich in information. In addition to the typology of certain objects, it provides insight into the crafts carried out at the site, into areas of activity and the intensity thereof, for example milling, fishing, grinding (metalworking). It also provides insight into the technology of tool production. From the Roman period onwards, natural stone research contributes to the knowledge of building materials and techniques. Provenance determinations of stone contribute to knowledge of trade contacts and networks. In some cases, natural stone can also contribute to the dating of the site, this is especially true of Roman and (Early) Medieval material. The regular research includes the macroscopic determination of the stone type and the object that was made from it. This includes qualitative features (color, shape, stone type, machining/use traces, type of artifact, typo-chronology, post-depositional traces) and quantitative features (size, number, weight and degree of fragmentation). Specific research is used to quantify the above qualitative properties, such as gaining a better understanding of stone types and their areas of origin; nature of use/production traces; conservation status and degradation processes of the different stone types in different soil environments. The following techniques are commonly used: 138 138 139 -=== **IJzerslak** === 134 +* microscopic analyses (transmitted/striking light); 135 +* X-ray diffraction (XRD), for mineralogical research. 136 +* microprobe and scanning electron microscope (SEM) for in situ analyses in an object. 140 140 141 -I Jzerslak kanvan verschillendeprocessen afkomstig zijn: productievanjzer,en hetzogenaamdeherverhittenensmeden van ijzer. Productie-, enherverhittingsslakkenwordenin verhouding minder vaakteruggevonden,veel vaker gaat het om smeedslakken. Productie slakken kunnen in situ liggen(slakkenhoop, in of naasteen oven,kuilovenslakin kuiloven). Herverhittings-ensmeedslakkenwordenook insitu aangetroffen (hamerslagineensmidse,smeedslakkenin een smeedhaard), meestal echterwordendegrotere exemplareninenafvalkuil gevondenof verspreidover deopgraving.Productieslakkenen smeedslakkenzijngrofwegalsvolgtteonderscheiden: productieslakkenhebbenvaak een metallischoppervlak en zijn nietmagnetisch;smeedslakken hebben vaak een roestiguiterlijk en zijn magnetisch;herverhittingsslakkenkunnen kenmerkenvanbeide voorgaandetypenslakhebben.138 +In addition, physicochemical analysis methods exist, such as neutron activation analysis (NAA), X-ray fluorescence (XRF), infrared spectrometry (IR) and many others to determine composition (major and/or trace elements). In some cases, it may be useful to determine physical properties such as specific gravity or breaking strength. 142 142 143 -= ==**IJzererts**===140 += Unburned/burned bones = 144 144 145 - Ditkan als erts op een ijzerproductie site wordengevonden ofals bouwmateriaalin een fundering.142 +== Nature (animal) == 146 146 147 - ===**Gebrande en gesinterde klei(van haarden, ovens)**===144 +Animal remains may be found as individual skeletal elements or fragments thereof (slaughter, consumption and production waste), but may also be found in anatomical context and form part of a more or less complete skeleton. The animal may have been sacrificed or otherwise deliberately buried, or may have died a natural death. The skeletal elements may be undamaged, but may also show signs of foraging, cutting, felling, or other processing. Animal remains may also be used to make objects (artifacts) or be part of an object composed of multiple materials (e.g., bone handle of an iron knife). 148 148 149 - Ditwordt vaak bij hetslakmateriaal aangetroffen. Gebrande klei van smeltkroezen of mallen kunnen samen met slakken voorkomen, maar dathoeftniet. Deze laatste materialenworden gebruikt voor het smelten en gieten van metalenzoals koper en brons en niet bij de vroege ijzerverwerking. Voorafgaand aan een opgraving moeten de resultaten van veldverkenningen besproken worden met specialisten. Met name uit boorresultaten kunnen voorspellingen gedaan worden over de locatie en aard van het te verwachten materiaal.146 +== Research (animal) == 150 150 151 - ==Onderzoek==148 +The importance of animal material for archaeology can hardly be underestimated. Among other things, the find group can contribute to the reconstruction of the landscape, to the knowledge of the development and health status of (domestic) animals in the past and to the interpretation of numerous socio-economic and religious aspects of past societies. These may include, for example, the food economy (whether there was, and if so, how hunting and animal husbandry were practiced), the relationship between meat consumption and social status, and craft production processes. 152 152 153 - Onderzoekaan slakken geeft inzicht in detechnologie en organisatiebinnen eensite en desociaal-economischeconditieswaarbinnen een site functioneertzowel op regionaalals bovenregionaalniveau. Daarnaast levert het slakonderzoek kennis opvan demateriëlecultuur en draagt het bij aan het totaalbeeld van desite.Onderzoeksvragen en mogelijkheden zijn sterkafhankelijkvan deperiode enbodemgesteldheid, daarom wordenhierondereen uitsplitsing gemaaktnaar specifiekeaandachtspunten perperiode en vondstomstandigheden.InNederlandwordteen onderscheidgemaakttusseneennatteen een drogecontext. De primaire uitwerkingvanhet onderzoekaanslakkenomvatdeterminatie,wegen, dateringenvaststellenvande archeologische context. Uit dit materiaalwordtvervolgenseen selectiegemaaktvoornaderonderzoek.Nahet makenvan een representatieve steekproefkan hetoverigemateriaal weg.Aanvullend op hetlakonderzoekworden alle botanischemonstersmetbehulpvan een röntgenapparaat gescandop hetvoorkomenvan klein slakmateriaal. Inoverleg met de botanischeafdelingworden de monsters verderverwerkt.Er bestaanenkelespecifiekeonderzoeksvormenen-technieken150 +The archaeozoological survey establishes qualitative (e.g., animal species, skeletal component, dentition) and quantitative characteristics (e.g., number, weight, degree of fragmentation). These basic data form the starting point for the archaeozoological investigation of a context or site. Objects can sometimes be dated typochronologically. There are some specific research forms and techniques: 154 154 155 -* Chemische analyse (XRF, ICP_AES, XRD) 156 -* Microscopische analyse (opvallend en doorvallend licht) 152 +* dating: the absolute age of bone material (burned and unburned) can be determined by 14C dating; 153 +* DNA analysis; 154 +* Chemical analysis; 155 +* Histological examination: small samples can be used to determine the difference between humans and animals, as well as the species. The state of preservation of the bone can also be determined; 156 +* Micro-wear analysis 157 + 158 +Micro-wear analysis can be used to determine the difference between humans and animals, as well as the animal species. The state of preservation of the bone can also be determined; 159 + 160 +== Nature (human) == 161 + 162 +Human skeletal material can be found in various forms. In inhumation graves, the skeleton usually lies in an anatomical position in a grave. The position in the grave can vary greatly. We distinguish between primary and secondary inhumation graves. Primary inhumation graves are those in which the intact skeleton is found, as it was deposited after death. Secondary inhumation graves are characterized by the fact that there is treatment of the body after death and before interment. In the case of a secondary burial, the parts of the skeleton are usually no longer in anatomical alignment. In addition to inhumation graves, cremation graves also occur. After burning, the cremation remains may have been left at the cremation site or placed in an urn or loose in a pit. Not all human skeletal remains are found in the context of an intentional burial. Bodies may have been abandoned or left behind without being formally buried. In addition, once deposited in the ground, skeletal elements may have been taken out of context by various processes and activities. Such skeletons are often incomplete, and recovered parts may show feeding marks, cut marks, bone fractures, and evidence of secondary burning. 163 + 164 +== Research (human) == 165 + 166 +From the skeleton, data on gender, age, height and pathology can be derived. As a result, skeletal material provides information about the demographics and health of past populations. Relationships to the food economy and lifestyle are important here. In conjunction with the archaeological context, such as tomb type and accessory items, traditions in the treatment of the dead are highlighted. Data on gender and age are important for the study of the social and cultural aspects of burial ritual within a population and/or between different populations in space and time. The study of human skeletal elements is part of physical anthropology. Physical anthropological research includes the inventory of skeletal parts present, the determination of gender, and the estimation of age and length. In addition, bone measurements, non-metric variation, and any pathological changes in the skeleton are documented. The description of cremation remains also includes data on weight, fragmentation, and degree of combustion. Skeletal material can also be utilized for specific research: 167 + 168 +* 14C dating: for the determination of the absolute age of bone material (burned and unburned); if AMS immediately also carbon and nitrogen isotope research! * DNA analysis: for the determination of genetic relationship and pathological examination (sample collection by or in consultation with specialist). 169 +* Chemical analysis: examination of stable isotopes and trace elements for the determination of paleo diet, toxic load and origin (arrange samples for biochemical examination with specialist). 170 +* Entomological examination: for the study of insects from the burial context (sample collection by specialist). 171 +* Microscopic examination: by means of histological examination it is also possible to determine the biological age of an individual. Here, the pipe bones and the teeth are used. Furthermore, histological examination can be used to further investigate pathological changes in the skeleton (samples do not need to be taken in the field). 172 +* Palynological examination: regional/local origin of individual, e.g. from floral by-products in burial pit (sample taken by specialist). 173 +* X-ray examination: to determine age at death and diagnose pathological changes in the skeleton. * Facial reconstruction: to reconstruct the face of individuals from the past on the basis of the skull. 174 + 175 += Slags/sintels = 176 + 177 +== Nature == 178 + 179 +This chapter deals with pyrotechnic process residues, or waste products released from exposure of material to fire. When first selected in the field, the following materials often end up in the slag category: iron slag, iron ore, burnt loam, and sintered material. A slag is a waste product of metal production, processing, and nonmetallurgical processes, such as lime burning, brick production, pottery production, and glass production and processing. Given its resistance to secondary degradation, the material will occur in virtually every site from the Bronze Age onward. An exception is burnt loam, which can in fact be very fragile. 180 + 181 +=== **Ironslag** === 182 + 183 +Iron slag can come from several processes: production of iron, and the so-called reheating and forging of iron. Production, and reheating slag are found comparatively less often, much more often they are forging slag. Production slag can lie in situ (slag heap, in or next to a furnace, pit furnace slag in pit furnace). Reheating and forging slag are also found in situ (hammered slag in a forge, forging slag in a forge hearth), however, usually the larger specimens are found in a waste pit or scattered throughout the excavation. Production slag and forging slag can be roughly distinguished as follows: production slag often has a metallic surface and is not magnetic; forging slag often has a rusty appearance and is magnetic; reheating slag may have characteristics of both previous types of slag. 184 + 185 +=== **Iron ore** === 186 + 187 +This may be found as ore at an iron production site or as building material in a foundation. 188 + 189 +=== **Burned or sintered clay** === 190 + 191 +This is often found with the slag material. Burnt clay from crucibles or molds may occur along with slag, but it need not. The latter materials are used for melting and casting metals such as copper and bronze and not in early iron processing. Prior to an excavation, the results of field explorations should be discussed with specialists. In particular, from drilling results, predictions can be made about the location and nature of the material to be expected. 192 + 193 +== Research == 194 + 195 +Snail research provides insight into the technology and organization within a site and the socio-economic conditions within which a site functions both at the regional and supra-regional levels. In addition, snail research provides knowledge of the material culture and contributes to the overall picture of the site. Research questions and possibilities are strongly dependent on the period and soil conditions, therefore a breakdown is given below into specific points of interest per period and find conditions. In the Netherlands a distinction is made between a wet and a dry context. The primary elaboration of the study of snails includes determination, weighing, dating and determining the archaeological context. From this material a selection is then made for further investigation. After making a representative sample, the remaining material can be discarded. In addition to the snail research, all botanical samples are scanned for the presence of small snail material using an x-ray machine. In consultation with the botanical department the samples are processed further. There are a few specific research forms and techniques 196 + 197 +* Chemical analysis (XRF, ICP_AES, XRD) 198 +* Microscopic analysis (incident and transmitted light) 157 157 * Microprobe/SEM 158 158 159 -= Onverkooldhout=201 += Unburned wood = 160 160 161 -== Aardenvoorkomen==203 +== Nature == 162 162 163 -In principe kaninNoordwest-Europain allezuurstofarmeennattemilieusonderhetgrondwaterniveauhoutinonverkooldevorm gevondenworden, als (on)bewerktmateriaaluitantropogenelagen, ofalsstammen,wortelstelselsen takjesuitnatuurlijkelagen.Onder goedeomstandighedenbewaardziethethoutonmiddellijknahet blootleggenstevigen solideuit,echter,zodrahet aan lucht,zonen windwordtblootgesteld,gaat dekwaliteitbinneneenaantaluren zienderogenachteruit.Vooral zuurstof,warmteen lichtbevorderende groeivanmaden,schimmelsen bacteriën.Hethoutkrimpt,scheurtenbegintvanafhet eerstemomenttedesintegreren. Indepraktijkishout éénvande meestkwetsbare materiaalgroepenop eenopgraving.Daarbij komtdatet bijdezemateriaalgroepvaak gaat omgrote structureneneengrootvolume waarvanhettekenenenverwerkenveeltijdkost.Bijeenopgravingwaarveelhout teverwachten is, moetruimtijdvoorhoutspecialistischonderzoek worden ingepland.205 +In principle, in northwestern Europe in all oxygen-poor and wet environments below the groundwater level wood can be found in an uncarbonized form, as (un)processed material from anthropogenic layers, or as trunks, root systems and twigs from natural layers. Stored under good conditions, the wood looks firm and solid immediately after uncovering, however, as soon as it is exposed to air, sun and wind, the quality deteriorates noticeably within a few hours. Oxygen, heat and light in particular promote the growth of maggots, fungi and bacteria. The wood shrinks, cracks and starts to disintegrate from the very first moment. In practice, wood is one of the most vulnerable material groups in an excavation. In addition, this material group often involves large structures and a large volume whose drawing and processing takes a lot of time. In an excavation where a lot of wood is to be expected, ample time should be planned for wood specialist research. 164 164 165 -== Onderzoek==207 +== Research == 166 166 167 - Houtwasin hetverledenéén vandemeestgebruiktegrondstoffenen werdgebruiktals bouwmateriaalvoor huizen,wegen, bruggenenbeschoeiingen,maarookvoor allerleiverschillendesoorten objecten,vanduikers totkleinehuishoudelijkevoorwerpen. Gezien hetgebruikvan houtvoor demeestuiteenlopendedoeleindeneneuiteenlopendevormen,geeftdeze vondstgroep inzicht in:209 +Wood was one of the most widely used raw materials in the past and was used as a building material for houses, roads, bridges and revetments, but also for all kinds of different objects, from culverts to small household objects. Given the use of wood for a wide variety of purposes and its diverse forms, this find group provides insight into: 168 168 169 -* demateriëlecultuur;170 -* socio-economi scheaspectenalsbijvoorbeeld handel, seizoensarbeid enorganisatiegraad vaneengemeenschap;171 -* deontwikkelingvantechnologischkunnenaandehandvan bewerkingstechnieken; -de natuurlijkehoutvegetatiein hetverleden;172 -* he tgebruikvandezenatuurlijkehulpbron doorde mens,bijvoorbeelddoor middel vanbeheer van lokalebosopstanden.211 +* material culture; 212 +* socio-economic aspects such as trade, seasonal labor and degree of organization of a community; 213 +* the development of technological ability through processing techniques; - the natural wood vegetation in the past; 214 +* the use of this natural resource by man, for example, through management of local forest stands. 173 173 174 - Daarnaasts eenheelbelangrijkaspectdemogelijkheidtotdaterendoormiddel van:216 +In addition, a very important aspect is the possibility of dating by means of: 175 175 176 -* dendrochronologi schonderzoek;177 -* 14C -datering;178 -* gebruiktebewerkingstechniekendiein sommigegevallen eenzeerglobaledateringkunnen aangeven.218 +* dendrochronological research; 219 +* 14C dating; 220 +* used processing techniques that in some cases can give a very rough dating. 179 179 180 - Alsmenbijeenvindplaatsrvan uitgaatdater veelhoutgevondenzalworden in verschillendestructuren,moetbijhet opstellenvan hetProgrammavan Eisenen/ofvoorafgaande aanhetonderzoekeenhoutspecialistgeraadpleegdwordenomerzekervantezijn datoptimale informatie verkregenwordtenonderzoeksvragengeformuleerdwordendiepassen binnen, ofeen aanvulling vormenop,dealgemenevraagstellingenvande te onderzoeken vindplaats. Soms wordtpas tijdensde opgravinghetwerkelijkepotentieelvanhet houtonderzoekvoor specifiekevindplaats duidelijk.222 +If one assumes that a lot of wood will be found in various structures at a site, a wood specialist should be consulted during the formulation of the Program of Requirements and/or prior to the survey to ensure that the best possible information is obtained and that research questions are formulated that fit within, or complement, the general issues of the site to be surveyed. Sometimes the true potential of wood research for specific deposits becomes clear only during excavation. 181 181 182 -= Houtinverkoolde enandereverhardevormen=224 += Wood in burned or hardened state = 183 183 184 -== Aardenvoorkomen==226 +== Nature == 185 185 186 - Houtskoolontstaatoorlangzameennvolledigeverbrandingvan houtonderzuurstofarme omstandighedenenbijtemperaturenvan300-400 gradenCelsius.Hetkan eenonopzettelijkbijproductzijnvaneennvolledig verbrandingsproceszoalsbijcrematies, inhaardenofincidenteleverbrandingvaneenhuis.Voor sommige industriëleactiviteitenzoalsvoor metaalbewerking wordthout ondergecontroleerdeomstandigheden metpzet omgezet tot houtskool.Houtinverkooldevorm iszeerbestendigtegenbiologischeaantastingenkandaaromzowelinnatte alsdrogemilieus teruggevondenworden,maarhet iszeergevoeligvoormechanischedruk.Houtwordtvaakingemineraliseerdevorm inbeerputtengevonden,bijvoorwerpensamengesteldvanbijvoorbeeldhouten metaal (lansschachten,grafkistenenrgelijke).228 +Charcoal is created by slow and incomplete combustion of wood under low-oxygen conditions and at temperatures of 300-400 degrees Fahrenheit. It can be an unintentional by-product of an incomplete combustion process such as in cremations, in fireplaces or incidental burning of a house. For some industrial activities such as for metalworking, wood is intentionally converted to charcoal under controlled conditions. Wood in charred form is highly resistant to biological attack and therefore can be found in both wet and dry environments, but it is very sensitive to mechanical pressure. Wood is often found in mineralized form in cesspools, among objects composed of, for example, wood and metal (lance shafts, coffins and the like). 187 187 188 -== Onderzoek==230 +== Research == 189 189 190 - De informatieuitverkooldhoutuitarcheologischecontextligtophetvlak van:232 +The information from charred wood from archaeological contexts is in the area of: 191 191 192 -* cultur eleinformatie,zoals houtkeuze(uitfunctionele, religieuzeoverwegingenenrgelijke)enhandel;193 -* vegetati ereconstructie;194 -* dat erend14C-onderzoek.234 +* cultural information, such as wood choice (from functional, religious considerations and the like) and trade; 235 +* vegetation reconstruction; 236 +* dating 14C research. 195 195 196 - Hetbelangvanhet houtskoolonderzoekendeprioriteitervan binnende algemenedoelstellingenvaneenvindplaatshangtinbelangrijkemateaf vandeanderemogelijkhedenom de verlangde informatieoverbijvoorbeeld de vegetatie te verkrijgeneninhoeverredehoutskoolaanvullende ofopzichzelfstaande informatieoplevert.Erzijn vindplaatsenwaar organischmateriaal alleenbewaard isgebleveninverkooldevormengegevensover vegetatiezijndat gevalop geen anderewijze teverkrijgendanuitditverkoolde materiaal. Tijdelijke jachtkampenuit metnamede paleo-en mesolithischeperiodenwordenvaakalleen indevormvanhaardenteruggevonden.238 +The importance of charcoal research and its priority within the overall objectives of a site depends to a large extent on the other possibilities for obtaining the requested information on, for example, vegetation and to what extent charcoal provides additional or stand-alone information. There are sites where organic material has only been preserved in charred form and in that case information about vegetation cannot be obtained in any other way than from this charred material. Temporary hunting camps from the paleo and mesolithic periods in particular are often found only in the form of hearths. 197 197 198 -= S chelpen=240 += Shells = 199 199 200 -== Aardenvoorkomen==242 +== Nature == 201 201 202 -S chelpenzijn de hardeuitwendigeskeletdelenvandeongewerveldeweekdierenofschelpdieren.Dezediergroepwordtookmollusken genoemd.Bij eenverdereindeling onderscheidenwe o.a.slakkenen tweekleppigen(mossels).Ook inktvissenbehoren totde mollusken. Somskunnenwevan inktvissende(inwendige) rugschildenofkakentijdensetopgraven aantreffen. Schelpenwordenop velemanierenalhonderdduizendenjarenordemensgebruiktenhun inhoud gegeten.Dewetenschapdiezichmetschelpenbezighoudtheetmalacologie. Schelpen bestaanvoor eengrootdeeluit koolzurekalk(calciumcarbonaat).Dewandisin veelgevallenopgebouwduitdrie lagen:eenbinnenstekalklaag(parelmoerlaag),eenmiddenlaagvankalk(prisma-ofporceleinlaag)eneenbuitenstelaagvanconchioline (opperhuid).Deopperhuidismeestal bruin ofzwartenmeestalzeerdun.Hetmateriaal is hoornachtigenkomtquasamenstellingovereenmet chitine(zoalswedatbijinsecten aantreffen).Meestalzijnschelpenstevigenkunnenlangengoedbewaardblijven indebodem.Door chemischeprocessenindegrondkandeschelpechterzachtworden ofdoor zurengeheel oplossen. Ineen van oorsprongkalkvrijegrond zijn geenschelpen teverwachten. Ishetsedimentechterkalkhoudenddankunnenzowel in natuurlijkealsantropogene afzettingengroteaantallenschelpenaanwezig zijn. Door grondbewegingen(onderandere opgraven)kunnen vooraldegrotere,dunneschelpenuitelkaarvallen. Schelpenofschelpfragmentenkunnenopallerleiplaatsengevondenworden.Dedierenkunnenterplekke geleefd hebben, schelpenkunnenaangespoeldzijn, hetkunnenvoedselresten zijnvanmens ofdier(schelpenhopen) ofresten vanlokaasenverderkunnenzegediendhebbenalssieraden(grafvondsten),versieringen(ornamenten), inleginander materiaal,kralen,knopen, cameeën,betalingsmiddel(geldkaurie), parelleveranciers, muziekinstrument,werktuigen, container,bakje, ritueeloffer,kleurstoffen(purper),wegverharding, bouwmateriaal e.d. Ingebrokenvormtreffenweschelpenaan als magering inaardewerk, mest, medicijn, gritvoor pluimveee.d.244 +Shells are the hard outer skeletal parts of the invertebrate mollusks or shellfish. This animal group is also called mollusks. In a further classification, we distinguish, among others, snails and bivalves (mussels). Cuttlefish also belong to the molluscs. Sometimes we can find the (internal) dorsal shields or jaws of cuttlefish during excavation. Shells have been used in many ways by humans for hundreds of thousands of years and their contents eaten. The science that deals with shells is called malacology. Shells consist largely of carbonated calcium (calcium carbonate). In many cases, the wall is composed of three layers: an inner layer of lime (pearl layer), a middle layer of lime (prism or porcelain layer), and an outer layer of conchioline (epidermis). The epidermis is usually brown or black and usually very thin. The material is horny and is similar in composition to chitin (as found in insects). Usually shells are firm and can be preserved in the soil for a long time and well. However, chemical processes in the soil can cause the shell to soften or dissolve completely due to acids. In an originally lime-free soil, shells are not to be expected. If the sediment is calcareous, however, large numbers of shells may be present in both natural and anthropogenic deposits. Soil movements (including excavation) may cause the larger, thin shells in particular to disintegrate. Shells or shell fragments can be found in all sorts of places. The animals may have lived there, shells may have washed ashore, they may be food remains of humans or animals (shell heaps) or remains of bait and furthermore they may have served as jewelry (grave finds), decorations (ornaments), inlays in other materials, beads, buttons, cameos, means of payment (cash cow), pearl suppliers, musical instrument, tools, container, tray, ritual/sacrifice, dyes (purple), road paving, building material e. d. In broken form, we find shells as magings in pottery, manure, medicine, grit for poultry etc. 203 203 204 -== Onderzoek==246 +== Research == 205 205 206 -S chelpenineen archeologischecontextkunnen belangrijke informatieopleveren.Vooral in prehistorischekustnederzettingenkunnenweekdiereneenbelangrijkecomponentvanhetvoedselpakket zijn geweest. Ingunstige gevallenkan zelfsmet behulpvanslijpplaatjes hetseizoenvanverzamelenbepaaldworden. Schelpenlevereneengoedebijdrage aande reconstructie vaneendeel vandeomgeving.Vragenals hoezag een kustgebiederuit,stroomde hetwater,Dierlijkmateriaalveranderdehetzoutgehalte,kwamer bosvoorkunnener meebeantwoord worden. Soms kunnen veranderingenindeomgevingdoornatuurlijkeofmenselijkeoorzaakmetbehulpvaneenmolluskendiagram (verloopsoorten enaantallen per laag) aangetoond worden. Ineengroterverband zijnschelpengeschikt omvroegere kustlijnentereconstrueren ofomhetklimaattebepalen. Soorten dienietinhet onderzoeksgebiedthuishorenkunnenietszeggen overhandel.Zeldzame schelpenin gravengeven statusaan.Kleinerwordende exemplarenvaneensoortin detijd wijzensomsopoverexploitatie.Onderzoekaande schelpenmageringvanhetaardewerkkan informatie geven overdeherkomstvande pottenbakkersklei. Sommige soorten zijnkenmerkendvoorbepaaldeperioden.Bij schelpenonderzoekwordtallereerstgekeken naardeaanwezigeoorten, hunaantallenenbijgegetensoortendegrootteklassenenhet gewicht.Verderonderzoekkanbetrekking hebben op:248 +Shells in an archaeological context can provide important information. Especially in prehistoric coastal settlements, mollusks may have been an important component of the diet. In favorable cases even the season of collection can be determined with the help of grinding plates. Shells make a good contribution to the reconstruction of part of the environment. Questions such as what did a coastal area look like, did the water flow, did animal material change the salinity, did forests occur can be answered with them. Sometimes changes in the environment due to natural or human causes can be shown with the help of a mollusc diagram (development of species and numbers per layer). In a larger context, shells are suitable for reconstructing past coastlines or for determining climate. Species that do not belong in the study area can say something about trade. Rare shells in graves indicate status. Smaller specimens of a species over time sometimes indicate overexploitation. Examination of the shell aging of pottery can provide information about the origin of the pottery clay. Some species are characteristic of certain periods. Shell research first looks at the species present, their numbers, and in the case of eaten species, size classes and weight. Further investigation may include: 207 207 208 -* Hetvaststellenvan deouderdomdoormiddel van 14C-datering, Uraan/Thoriumen aminozuurracemisatie(overlegmet specialist,bijaminozuurracemisatie mag bijvoorbeeldhetmateriaal nietverhitworden).209 -* Samenstellingschelp(chemischeanalyse).210 -* Period evansterven (groeiringenonderzoekmet behulp vanslijpplaatjes).211 -* Gebruikssporen,bewerkingssporen (niet wassenmet stevigeborstels, niet inaanraking latenkomenmet metaal,dus ooknietzevenopmetaalmaaropbijvoorbeeldplasticzeven, niet nummerenop de schelpmaar alle schelpenineenapartzakjemet nummer, niet impregneren/conserveren, drogenmag).212 -* Veranderingeninverzamelplaats, - intensiteitofmilieu (veranderingeninafmetingenbinnendesoortenindeloopvan de tijd).213 -* Herkomst door deanwezigheid van resten of boorgatenvanandereorganismenopofinde schelp vast te stellen(niet wassenmet hardeborstels e.d.).214 -* Klimaat (O16/O18, C12/C13)215 -* Samenstellingenherkomst van water (stabiel isotopenonderzoek)216 -* Vervuilingen industriëleactiviteiten(geochemischonderzoek).250 +* Establishing the age by means of 14C dating, Uranium/Thorium and amino acid racemization (consult with specialist, for example in the case of amino acid racemization the material may not be heated). 251 +* Composition of shell (chemical analysis). 252 +* Period of dying (growth rings examination using grinding plates). 253 +* Traces of use, traces of processing (do not wash with strong brushes, do not let it come into contact with metal, so do not sieve on metal either but on plastic sieves for example, do not number the shell but put all the shells in a separate bag with number, do not impregnate/conserve, drying is allowed). 254 +* Changes in collection location, - intensity or environment (changes in size within species over time). 255 +* Provenance by establishing the presence of remains or boreholes of other organisms on or in the shell (do not wash with hard brushes, etc.). 256 +* Climate (O16/O18, C12/C13). 257 +* Composition and origin of water (stable isotope research) 258 +* Pollution and industrial activities (geochemical study). 217 217 218 -= Insect enen mijten=260 += Insects and mites = 219 219 220 -== Aardenvoorkomen==262 +== Nature == 221 221 222 - Dithoofdstukbehandelt chitineuzeresten.Hetzijnrestenvandegrote groepdergeleedpotigedieren(Arthropoda),dieonderanderede kreeftachtigen,duizend-en miljoenpoten, mijtenenanderespinachtigenen insecten omvat. Indearcheologieworden voornamelijk insectenen mijtengebruikt. Eetbarekrabbenenanderekreeftachtigenzijndoorhun groottequaverzamel-enverwerkingmethodevergelijkbaarmetbotmateriaal. Chitineiseenzeer sterke stof die onderde juisteomstandighedenzeerlangbewaardkanblijven.Gunstigeomstandigheden zijnbijvoorbeeldnatte anaërobe(zuurstofarme) condities,maarookonderextreemdrogeomstandighedenkunnendestenvaninsectenen mijtengoed bewaard blijven.Funestvoordekwaliteitvan conservering,zowelvoor als ooknamonstername, zijn sterkewisselingeninvochtigheidsgraad. Slechts bij uitzonderingzijnresten van mijtenofinsectenmethetblote oogwaarneembaartijdenseenopgraving.Dit betreftdan meestal concentratiesvanvliegenpoppen(bijvoorbeeldin gravenofbeerputten) ofdekschildenvanrotekevers. Iniedereafzettingkunnenechterde microscopischerestenvangeleedpotigeierenwordenaangetoond. Uiteraard bestaanerwelgroteverschillen in dichtheid,kwaliteitvan conserveringenaarmeebruikbaarheidvandeaanwezigefauna’s. AlsvuistregelkanbinnendeNederlandse archeologieworden aangehouden datnattere, lagergelegen afzettingeneerder bruikbare monsterszullenopleverendan hogere, drogereafzettingen. In sommigegevallenzijnarthropodenrestenverkoold ofgemineraliseerdenzijndan nogredelijkte identificeren.Naasthet nemenvan grondmonstersiserenaantalspecifiekeremogelijkhedenomgeleedpotigente verzamelenbinneneen archeologischecontext.Zokunnen ertussen de tanden van kammen en inplukkenhaarof textiel restenvan(parasitaire) insectenwordengevonden enookopofinmenselijkerestenzijn resten van allerlei informatieve organismentevinden.264 +This chapter deals with chitinous remains. They are remains of the large group of arthropods (Arthropoda), which includes the crustaceans, centipedes and millipedes, mites and other arachnids and insects. In archaeology, insects and mites are primarily used. Edible crabs and other crustaceans are similar to bone material in terms of collection and processing due to their size. Chitin is a very strong substance that can be preserved for a very long time under the right conditions. Favorable conditions include wet anaerobic (oxygen-poor) conditions, but insect and mite remains can also be preserved well under extremely dry conditions. Strong fluctuations in humidity are disastrous for the quality of preservation, both before and after sampling. Only exceptionally will remains of mites or insects be visible to the naked eye during an excavation. These are usually concentrations of fly pupae (e.g. in graves or cesspools) or the wing-cases of large beetles. In any deposit, however, the microscopic remains of arthropods can be detected. Of course there are large differences in density, quality of preservation and thus usability of the faunas present. As a rule of thumb within Dutch archaeology, wetter, lower lying deposits are more likely to yield usable samples than higher, drier deposits. In some cases arthropod remains are carbonized or mineralized and can then still be reasonably identified. In addition to soil sampling, there are a number of more specific ways to collect arthropods within an archaeological context. For example, remains of (parasitic) insects can be found between the teeth of combs and in tufts of hair or textiles, and remains of all kinds of informative organisms can also be found on or in human remains. 223 223 224 -== Onderzoek==266 +== Research == 225 225 226 - Onderzoekaanrestenvangeleedpotigenkentveelmogelijkheden. Enerzijdsis er informatieteverkrijgen overklimaathap, waarbij metbehulpvangevleugeldeinsectenookrelatief snelleveranderingendaarinkunnenwordengedetecteerd.Anderzijdskunnenmijten,ongevleugeldeinsectenen insectenlarven informatie geven overomstandigheden opzeerkleineschaal.Doordatergveel soortengeleedpotigen zijnendoordatzelevenonderzeeruiteenlopendeen vaak zeer specifiekeomstandigheden,kan ook de informatieopallerleizakenbetrekkinghebbenenookzeer specifiek zijn.Bijvoorbeeld: roofmijtenin mestoverdeproducent ervan,voorraadinsectenoveromstandighedenvanvoedselopslag, ectoparasietenzoals luizenenvlooienover hungastheer,vliegenpoppenenandereinsectenoverdeomstandighedentijdensenvoorafgaandeaaneeninhumatie(vergelijkforensischeentomologie).Opdezewijzekunnenderestenvangeleedpotigenextra informatie verschaffen overveeteelt-en landbouwtechniekenenaarmeeookoverdevoedseleconomie,maarbijvoorbeeldookovermateriaalgebruikenleefomstandigheden. Behalvedat wemijten eninsectengebruikenals indicatoren,speeldenzevaakookeenbelangrijkerolinhet levenvandemens: als plaagdiervoordeeigengezondheid, inde dierlijkeen plantaardigeproductie, inde opslag,en ingebruikte materialen,maarsoms ookalsvoedselofalsmedicijn.Hetreguliereonderzoekleidtnormaalgesprokenvoor elkmonstertoteenaldan niet(semi-) kwantitatievesoortenlijstvaneen ofmeerdiergroepen. In combinatiemetanderegegevensisditde basisvoor interpretaties. Opmerkingenmet betrekkingtot bijvoorbeeldconserveringstoestandoffragmentatie-patronenkunnenineenlater stadium nuttigzijnbij het interpreterenvantafonomischeprocessen. Indepraktijkblijkthet vrijwelondoenlijkomniet tewerkenmeteenonderzoeksstrategiein twee stappen:eersteenwaarderingsonderzoekgevolgddooreen analysefasevan(eenselectie van) hetmateriaal.De absoluteouderdomvanchitineuzerestenkan doorddelvan 14C-datering wordenvastgesteld,waarbijalsregelkanwordenaangehoudendateen object dateerbaarismetbehulpvan deversnellermethodezodrahetmethet blote oogzichtbaaris.Metbehulpvande Mutual Climatic Range-methodekanvoortsvangroterevondstcomplexengetrachtwordendepaleo-klimatologischegegevenstekwantificeren.268 +Research on arthropod remains has many possibilities. On the one hand, information can be obtained about climate and landscape, where with the help of winged insects relatively rapid changes in these can also be detected. On the other hand, mites, unwinged insects and insect larvae can provide information about conditions on a very small scale. Because there are very many species of arthropods and because they live under very different and often very specific conditions, the information can also relate to many things and also be very specific. For example: predatory mites in manure on its producer, stock insects on conditions of food storage, ectoparasites such as lice and fleas on their host, fly pupae and other insects on conditions during and prior to an inhumation (compare forensic entomology). In this way, the remains of arthropods can provide additional information on livestock and agricultural techniques and thus on the food economy, but also, for example, on material use and living conditions. Besides being used as indicators, mites and insects often played an important role in human life: as pests for their own health, in animal and plant production, in storage, and in used materials, but sometimes also as food or medicine. The regular survey normally leads for each sample to a species list, quantitative or otherwise, of one or more animal groups. In combination with other data, this is the basis for interpretations. Observations concerning, for example, conservation status or fragmentation patterns can be useful at a later stage in interpreting taphonomic processes. In practice it proves to be almost impracticable not to work with a two-step research strategy: first an appreciation study followed by an analysis phase of (a selection of) the material. The absolute age of chitinous remains can be determined by means of 14C dating, whereby as a rule it can be assumed that an object is dateable using the accelerator method as soon as it is visible to the naked eye. Furthermore, using the Mutual Climatic Range method, an attempt can be made to quantify the paleo-climatic data of larger find complexes. 227 227 228 -= Leer = 270 += Leather = 229 229 230 -== Aardenvoorkomen==272 +== Nature == 231 231 232 - Onder leerwordeendierlijkehuidverstaan,dieopeenof anderewijze behandeld isombederftegenegaan. Indepraktijk zal de archeoloog inNoordwest-Europauitsluitendmetplantaardiggelooidleertemaken hebben,aangezienanderemethodenniet waterbestendigzijnendusinonsklimaatzeldenbewaardblijven. In enkelebijzonderesituaties (bijvoorbeeldingrafkelders ofonderkerkvloeren)kanleer droogbewaardzijn.De handelswijzeis in dat geval gelijkaandatvandroogtextiel. In principekunnenlederenvoorwerpenverwachtwordenin alleanaerobe,vooral waterrijkemilieus (ophogingslagen,terpen, diepekuilen,grachten, ouderivierlopen,aanplempingenen stadsuitbreidingen).Er zal, bijhetgraven indergelijkesituaties,vanbeginafaanrekening gehoudenmoetenwordenmet de specialeeisenaangaande reiniging, conservatieenopslagvanorganischematerialen(leer,hout, textiel),ookopdeopgravingzelf. Aldeze materialenmoetenonmiddellijkbehandeldworden,enkunnenniet‘voorlopig’ineenbakwatergelegdworden.De projectleiderzal het verwerkings-trajectvooraf al goedvoor ogen moetenhebben.Bijde financiëleplanningvooriederonderzoek in waterrijkemilieus(waterlogged conditions)zaleenvastpercentagevande begrotingbij voorbaatgereserveerdmoetenwordenvoor conservering,opslagbestuderingvanorganischematerialen.De ervaringen in Londonlerendatdezereserve inde ordevan gootteis van10-20%.274 +Leather means an animal skin that has been treated in some way to prevent decay. In practice, archaeologists in northwestern Europe will only have to deal with vegetable tanned leather, since other methods are not water-resistant and thus rarely preserve it in our climate. In a few special situations (e.g., in crypts or under church floors) leather may have been preserved dry. In that case, the method of handling is similar to that of dry textiles. In principle, leather objects can be expected in all anaerobic, mainly water-rich environments (embankments, mounds, deep pits, canals, old river courses, embankments and urban expansions). When digging in such situations, the special requirements for cleaning, conservation and storage of organic materials (leather, wood, textiles) must be taken into account from the start, even on the excavation site itself. All these materials must be treated immediately, and cannot be put in a tub of water 'for the time being'. The project leader will have to have the processing route well in mind beforehand. In the financial planning for each research project in waterlogged conditions, a fixed percentage of the budget must be reserved in advance for the conservation, storage and study of organic materials. The experience in London shows that this reserve is in the order of 10-20%. 233 233 234 -== Onderzoek==276 +== Research == 235 235 236 -Leer is he tplasticvande oudheiden werdvoor allerleidoeleindengebruikt.Dezeergevarieerdevoorwerpen-maarook hetproductieafval-geveninzicht indemateriëlecultuur,de aardvandenederzetting,de organisatie van productie en nijverheid,welvaartenhandelsrelaties.Hetmeestvoorkomendproduct is lederenschoeisel,dat inzowelde RomeinseTijdalsdeMiddeleeuwengoedte daterenisen tevens informatieoverbevolking,gezondheiden statusverschaft. IndeRomeinseTijdwordleerveelvuldiggebruiktor militairedoeleinden,zoals tenten,paardentuig,zadels,hoezen voorschildenenanderemilitaireuitrusting. Inde Middeleeuwenkomen riemen, beurzen,zwaard-enmesscheden, etuisvoor boeken,brillenenrgelijkenaast hetschoeiselveelvuldigvoor.Bij hetegenvan waterputtenmoetrekeninggehouden wordenmet rituele deposities vanschoeisel. Determinatievandediersoortenlevertinformatieopoverveehouderij.Momenteelishetnut van chemischonderzoekaan leernietbewezenbijnat materiaal.Bijdroogleerdientmendespecialist teraadplegen over onderzoeksmogelijkheden.Hetonderzoekvan leerrichtzichopidentificatie van voorwerpen,kwantitatieve analysevanomvangrijkevondstgroepenen interpretatiebinneneenculturelecontext.278 +Leather is the plastic of antiquity and was used for a variety of purposes. The highly varied objects - as well as production waste - provide insight into material culture, the nature of settlement, the organization of production and industry, prosperity and trade relations. The most common product is leather footwear, which can be dated well in both the Roman and Middle Ages and also provides information about population, health and status. In Roman times leather is used extensively for military purposes, such as tents, horse harnesses, saddles, shield covers and other military equipment. In the Middle Ages, belts, purses, sword and knife sheaths, cases for books, spectacles and the like are common in addition to footwear. Ritual deposits of footwear should be taken into account when emptying wells. Determination of animal species provides information on animal husbandry. Currently, the usefulness of chemical examination of leather is not proven for wet material. For dry leather, one should consult the specialist about research possibilities. Leather research focuses on object identification, quantitative analysis of large find groups, and interpretation within a cultural context. 237 237 238 -= Texti el =280 += Textile = 239 239 240 -== Aardenvoorkomen==282 +== Nature == 241 241 242 - Onderbijzondereomstandigheden,afhankelijkvandezuurgraadenerelatievevochtigheid indebodem,kantextielbewaardblijven. Textilia,gemaaktvanzowelplantaardige(linnen,katoen) alsdierlijke(wolenzijde)vezels,kunnen onder extreem drogeomstandigheden (graven,holtes inbouwwerken)min of meer intactblijven.In deoverwegendzure ennattebodemsdaarentegenblijvenleende dierlijkevezelsbewaard. Plantaardigeweefsels blijvenin Nederlandverder alleenbewaardindienzijinzeerkalkrijke omgevingdoor mineralisatieverharden (beerputtenmet mortelresten). Invroegmiddeleeuwsegravenopde zandgrondenkantextiel (indirect)bewaard blijvenin de oxidatielaagvaneenmetalenvoorwerpdat alsbijgift aande dodeismeegegeven.Tijdenshet eeuwenlangeverblijf indebodemwordthetmeestetextiel aangetastdoorbacteriënenschimmels.Bovendienwerdtextielvaak verknipt totkleineretukken.Hierdoorwordenalleenrelatiefkleinefragmentenopgegraven.Grote stukkenzoalsherkenbare kledingstukkentreftmenvoornamelijkaan ondernatte omstandigheden (gracht,veen) ofin drogegraveninkerken.284 +Under special conditions, depending on the acidity and relative humidity in the soil, textiles can be preserved. Textilia, made of both plant (linen, cotton) and animal (wool and silk) fibers, can remain more or less intact under extremely dry conditions (digging, cavities in structures). In contrast, in the predominantly acidic and wet soils, only the animal fibers are preserved. Plant tissues are further preserved in the Netherlands only if they harden by mineralization in very calcareous environments (cesspools with mortar remains). In early medieval graves on sandy soils, textiles may be preserved (indirectly) in the oxidation layer of a metal object that was given to the deceased as an accessory. During centuries of residence in the soil, most textiles are affected by bacteria and fungi. In addition, textiles were often cut up into smaller pieces. Therefore only relatively small fragments are excavated. Large pieces such as recognizable garments are mainly found under wet conditions (moat, peat) or in dry graves in churches. 243 243 244 -== Onderzoek==286 +== Research == 245 245 246 - Hoewelkledingnaastvoedseltotdebasisbehoeftenvandemensbehoort,is vanwegede grotevergankelijkheidvanhetmateriaalmaarweinigbekendoverkleding indepre-en protohistorie. In museatreftmenalleenkledingaan vanafdezeventiende eeuw.Het betrefthierkledingvande hogerestandenofkleding vanhistorischbekendepersonen.Kledingvandegewonemanontbreekt.Dezewerd destijdseindeloosherstelden/of verknipt totkleineretukkenbruikbaarvooranderekleding.Veeltextiel eindigde alspoetslap. Geziendegeringekansdattextielwordtaangetroffen, ishetnoodzakelijk datieder fragmentwordtonderzocht,ookdekleinstesnipper.Menkan alveelinformatie halenuit 1cm2. Vaniederetextielvondstwordthetverwerkte materiaal onderzocht.Bijluxeweefselskanmenmetaaldraden,aldannietgeoxideerd,verwachten. Verder wordtonderzocht welkevervaardigingstechniek(en) toegepastzijn:viltmaken, spinnen, weven,vlechten,breien, borduren,naaien, etc.Dankzijonderzoekvantextieldoor deeeuwenheenkan menontwikkelingen intoegepaste materialenen techniekenonderzoeken.Bijgroterestukkenkanmenkledingreconstrueren.Hetvoorkomen van kostbareweefselsverschaftinformatieoverhandelen status.Indienmen een opgravinggaatopstarten ineengebied waarmenveel organischmateriaalverwacht,dientmenbij de(financiële) planningrekeningtehoudenmet conserveringenbestuderingvantextielvondstenaangezien, textiel vrijsnelnadeopgravingbehandeldmoetworden(zokan binnenenkeledagen/wekenschimmelgroei optreden).Wilmen specifiekeonderzoekstechniekentoepassendan dientmenvóór reinigingspecialemaatregelente treffen.288 +Although clothing is one of man's basic needs next to food, because of the great impermanence of the material, very little is known about clothing in pre- and protohistory. In museums, one finds only clothing from the seventeenth century onward. These are the clothes of the higher classes or of historically famous people. Clothing of the common man is missing. This was then endlessly repaired and/or cut into smaller pieces usable for other clothing. Many textiles ended up as cleaning rags. Given the low probability of finding textiles, it is necessary that every fragment be examined, even the smallest shred. A lot of information can already be extracted from 1 cm2. The processed material of each textile find is examined. With luxury fabrics one can expect metal threads, whether or not oxidized. Furthermore, the technique of fabrication is investigated: felt-making, spinning, weaving, braiding, knitting, embroidering, sewing, etc. Thanks to the study of textiles through the ages, developments in applied materials and techniques can be investigated. In the case of larger pieces, one can reconstruct clothing. The occurrence of valuable fabrics provides information about trade and status. When starting an excavation in an area where a lot of organic material is expected, the (financial) planning has to take into account the conservation and study of textile finds since, textiles have to be treated soon after the excavation (e.g. fungal growth can occur within a few days/weeks). If one wants to apply specific research techniques then special measures have to be taken before cleaning. 247 247 248 -= Cerami ekuitRomeinsetijd, Middeleeuwenen NieuweTijd=290 += Ceramics from Roman times, Middle Ages and New Times = 249 249 250 -== Aardenvoorkomen==292 +== Nature == 251 251 252 -Cerami ekis eenverzamelnaamvoorvoorwerpenvangebakkenklei.Defysieke eigenschappenvanceramiek lopensterkuiteen,afhankelijkvandegebruiktegrondstoffen,dekleibereiding,devormtechniekenenkenvanhet bakkenen eventueel glazuren. Archeologen makenvaakeenweinig zuiveronderscheidtussen“handgevormde”en“gedraaide ceramiek”waarbijheteerste(vrijwel)geheelzonderdraaischijfis vervaardigd. Indegelijksepraktijkwordt deaanduiding“gedraaide ceramiek”(draaischijfaardewerk), hoewelditfeitelijk geheelonterechtis,nietalleengebruiktvoor ceramiekdie isvervaardigdmeteendraaischijfmaarookvoorin mallengevormdeceramiekofzelfsbijvoorwerpen,die ineengecombineerdehandgevormdeengedraaide techniekzijn vervaardigd(bijvoorbeeld bordenenkoekenpannenvanlaatmiddeleeuwsrood aardewerk).Heteindresultaatvandegrondstoffenbereidingenhetbakkenvandeklei wordtmetde term“baksel” aangeduid. Bakselswordendoorgaansonderscheiden opgrond vankorrelgrootte-verdeling, type magering, hardheid, porositeit, structuurvanhetbreukvlakenkleuren, soms ookdeoppervlaktebehandeling.Als grondstoffenkunnen uiteenlopendesoorten klei zijn gebruikt,eventueelgemengdmetanderekleisoortenofgrondstoffen(bijvoorbeeldkalkindepostmiddeleeuwsefaience).Vaak bevat hetbakseleenzandfractie,meteenkorrelgrootte tussende0,1en 1 mm, soms ookanderesteneninsluitselstoteenkorrelgroottevanenkelemillimeters (“kiezels”,“grind”), waarbij dehoeveelhedensterkuiteenkunnenlopen.Dezezandfractiekanofwelvan nature indegedolvenkleihebben gezeten,ofwel naderhand bij dekleibereidingzijn toegevoegd.Hoewelalleendit laatstetechnischgezien“magering” mag worden genoemd,wordenindepraktijkvaakallemet hetbloteoogzichtbarekorrelsals“magering”betiteld.Eenbakselkanookmageringbevattenvanorganischmateriaal (schelpgruis, stro,meestalalleenalsholtesna hetbakkenvandekleizichtbaar) ofvanpotgruis(chamotte, somsmoeilijkteonderscheidenvan verkleurdevlekjesvannatuurlijkeijzerconcentraties indeklei).Door eenbeheersingvanhogeretemperaturenkunnenharderebaksels ontstaan. Ineen ovenkunnendetemperaturenzoveropgevoerdwordendat hetrekristallisatiepunt (“smeltpunt”)vaneen kleisoortwordt overschredenenkleivankristalstructuurverandert.Hierbijkan dekleiversinterenwaarbijhetbakselzeer hardwordtendeporositeitwordt gereduceerd toteenglasachtige dichtheid.Men spreektdanvan “steengoed”of“porselein”. Indeanderegevallenwordttbakselbeschrevenals“aardewerk”.Aardewerk kentuiteenlopendeadatiesvanhardheidmaarhiervoorzijngeenvastomlijndenormen. Somsis er grootverschiltussende hardheidaanhetoppervlakende hardheidvanhetbinnenste,“debreuk”.294 +Ceramics is a collective term for objects made of fired clay. The physical properties of ceramics vary widely, depending on the raw materials used, the clay preparation, the forming techniques, and the techniques of firing and possibly glazing. Archaeologists often make a not very clean distinction between "hand-formed" and "turned ceramics" with the former being made (almost) entirely without a turntable. In everyday practice, the designation "turned ceramics" (turntable pottery), although in fact entirely unjustified, is used not only for ceramics made with a turntable but also for ceramics molded in molds or even for objects, which were made in a combined hand-formed and turned technique (e.g., plates and frying pans of late medieval red earthenware). The end result of the raw material preparation and firing of the clay is referred to by the term "bake". Bakes are usually distinguished according to grain size distribution, type of magnesium, hardness, porosity, structure of the fracture surface and colors, sometimes also the surface treatment. Various types of clay may have been used as raw materials, possibly mixed with other types of clay or raw materials (for example, lime in post-medieval faience). Often the firing contains a sand fraction, with a grain size of between 0.1 and 1 mm, sometimes also other stone inclusions up to a grain size of a few millimeters ("pebbles", "gravel"), whereby the quantities can vary greatly. This sand fraction may have either been naturally present in the mined clay or may have been added subsequently during clay preparation. Although technically only the latter may be called "magering," in practice all grains visible to the naked eye are often referred to as "magering." A biscuit may also contain magering from organic material (shell grit, straw, usually only visible as cavities after the clay has been fired) or from pot grit (chamotte, sometimes difficult to distinguish from discolored spots from natural iron concentrations in the clay). Controlling higher temperatures can produce harder bricks. In an oven, the temperatures can be raised so far that the recrystallization point ("melting point") of a clay type is exceeded and the clay changes its crystal structure. In this process, the clay may become sintered and the biscuit becomes very hard and the porosity is reduced to a glass-like density. One then speaks of "stoneware" or "porcelain". In other cases, the biscuit is described as "pottery". Earthenware has varying degrees of hardness but there are no well-defined standards for this. Sometimes there is a big difference between the hardness of the surface and the hardness of the interior, "the fracture". 253 253 254 -== Onderzoek==296 +== Research == 255 255 256 -Ceramie kwordtverzameldvooruiteenlopendedoeleinden:298 +Ceramics are collected for a variety of purposes: 257 257 258 -* dateren van grondsporen, 259 -* sociaal-economische aspecten van vondstcomplexen, 260 -* onderzoek van gebruiksfuncties van voorwerpen, 261 -* onderzoek van typochronologie, productie, handel en consumptie van ceramiek. 300 +* dating of ground tracks, 301 +* socio-economic aspects of find complexes, 302 +* research into the use of objects, 262 262 263 -Bij het onderzoek van ceramiek zijn tal van methoden en technieken in gebruik. Gezien de grote omvang van de hier beschreven periode (verschillende periode-specialismen) is deze tekst niet de plaats om nader in te gaan op determinatie van ceramieksoorten, onderzoek naar aardewerktechnologie, gebruikssporen, productie, handel en consumptie van ceramiek, om nog maar niet te spreken over de eventuele inzet van natuurwetenschappelijke middelen. Van de betrokken veldarcheoloog wordt in deze ook enige specialistische kennis verwacht. Wel kunnen enkele opmerkingen worden gemaakt over kwantificeren. Doordat er veel verschillende methoden zijn, wordt de vergelijkbaarheid van onderzoeksresultaten niet bevorderd. De meeste archeologen passen na het wassen zoveel mogelijk scherven aan elkaar, determineren het en tellen de aantallen. Ongemerkt worden daarbij verschillende werkwijzen aangehouden. Voorbeelden: inventariseren van alleen randen en/of bodems of tevens van de wandfragmenten, inventariseren van fragmenten zonder ze eerst te passen of ná het passen, het wel of niet tellen van de overgebleven wandfragmenten die na het passen niet zijn verbonden met rand- of bodemfragmenten, of het wel tellen van wandfragmenten van zeldzame, of versierde, of specifiek gevormde ceramiek maar het niet meetellen van minder goed determineerbare wandfragmenten. Hoe gaat men om met wandfragmenten die hoogstwaarschijnlijk behoren bij bepaalde rand- of bodemfragmenten maar die niet passen. Het verdient dus aanbeveling om vast te leggen op welke wijze de tellingen tot stand zijn gebracht, want de methoden zijn lang niet zo universeel als wel gedacht wordt. Inmiddels komen ook andere methoden voor kwantificatie in gebruik, zoals het meten van randpercentages of het wegen van vondstmateriaal. 304 +research into typochronology, production, trade and consumption of ceramics. 305 +Numerous methods and techniques are in use in the study of ceramics. Because of the large scope of the period described here (various period specialties) this text is not the place to go into more detail on the identification of ceramic types, research into pottery technology, traces of use, production, trade and consumption of ceramics, not to mention the possible use of natural scientific means. The field archaeologist involved is also expected to have some specialist knowledge in this area. Some remarks can be made about quantification. Because there are many different methods, the comparability of research results is not promoted. After washing, most archaeologists fit as many shards as possible together, identify them and count the numbers. Unnoticed in the process, different methods are adhered to. Examples: making an inventory of only the rims and/or bases or also of the wall fragments, making an inventory of fragments without first fitting them or after fitting them, counting or not counting the remaining wall fragments that after fitting are not connected to rim or base fragments, or counting wall fragments of rare, or decorated, or specifically shaped ceramics but not counting those that are less easy to identify. How does one deal with wall fragments that most likely belong to certain edge or bottom fragments but do not fit. It is therefore advisable to record how the counts were made, because the methods are not nearly as universal as is sometimes thought. Meanwhile, other methods of quantification are also coming into use, such as measuring edge percentages or weighing find material. 264 264 265 -= Prehistori schaardewerk=307 += Prehistoric pottery = 266 266 267 -== Aardenvoorkomen==309 +== Nature == 268 268 269 - Dithoofdstukbehandelt prehistorischaardewerk,zowel vaatwerkals voorwerpenvangebakken klei. Vaatwerkomvatvoorwerpen als potten,kommen,schalenenanderserviesgoed.Hetvaatwerk isgemaaktvanklei.Afhankelijkvandegrondstoffendieoordekleizijnemengd endebakwijze is hetaardewerkhardofzacht.Deverschralingkanbestaanuit potgruis(chamotte/schervengruis), organischmateriaal (plantenresten, stro), mineralemagering (grind, steengruis,gebrokenkwarts,veldspaten, granietsoort).Devoorwerpenzijn meestal ineen openvuurgebakkenwaarbijde temperatuurlaagbleefen hetaardewerkniet compleet hardwerd.Devoorwerpenvangebakkenklei kunnenzijn gebruiktals weefgewicht, netverzwaarderofspinklosje.Dezevoorwerpenzijn meestal niethardgebakkenensoms zelfshelemaalnietgebakken.Devoorwerpenzijnoverhetalgemeennietverschraald.Ookkunnenschervenvan pottenhergebruiktzijnals spinschijfje ofweefgewicht.Dit istezienaandeafrondingvandebreukvlakken(pasopvoor verweringvanhetmateriaal,dit geeftnamelijkbijnahetzelfderesultaat).311 +This chapter covers prehistoric pottery, both crockery and objects made of fired clay. Dishware includes objects such as pots, bowls, platters, and other tableware. Crockery is made of clay. Depending on the raw materials mixed through the clay and the firing method, the pottery is hard or soft. The scatter may consist of pottery (chamotte/sherd grit), organic material (plant remains, straw), mineral maging (gravel, stone grit, crushed quartz, feldspars, granite). The objects were usually fired in an open fire where the temperature remained low and the pottery did not completely harden. Baked clay objects may have been used as weaving weights, net weights, or spinning weights. These objects are usually not fired hard and sometimes not fired at all. The objects are generally not scorched. Shards of pots may also have been reused as spinning wheels or weaving weights. This can be seen by the rounding of the fracture surfaces (beware of weathering of the material, as this gives almost the same result). 270 270 271 -== Onderzoek==313 +== Research == 272 272 273 - Erbestaanmetbetrekkingtotprehistorischaardewerk verschillendeonderzoeksmogelijkheden: -Macroscopischonderzoekoptechnologischen morfologischekenmerken.315 +Several research options exist with respect to prehistoric pottery: -Macroscopic examination for technological and morphological characteristics. 274 274 275 -* Slijpplaatjes-onderzoekomdeherkomstvan hetbakselofdesamenstellingvande mageringtebepalenofomdemaakwijze vasttestellen.276 -* Dat erendonderzoek, typochronologischofvia 14C-datering.277 -* Functie bepaling van hetaardewerk,zodatmogelijkdegebruikscontextkan wordenbepaald.278 -* Chemi scheanalyse(XRD, röntgendiffractievoor mineralogischonderzoek vande magering).279 -* Diatom eeënanalyse:vaststellenzoet-ofzoutwaterafzettingvangebruikteklei317 +* Grinding research to determine the origin of the firing or the composition of the magma or to establish the method of manufacture. 318 +* Dating research, typochronological or via 14C dating. 319 +* Function determination of the pottery, possibly to determine the context of use. 320 +* Chemical analysis (XRD, X-ray diffraction for mineralogical research of the magering). 321 +* Diatom analysis : determination of fresh or salt water deposition of used clay 280 280 281 - Bijhetaardewerkonderzoekwordenkwalitatieve (zoalsbijvoorbeeldmagering, potvorm,bakwijze,versiering, rand-enbodemtype,verwering,kleur, typologie, periodisering, secundairesporenen postdepositionelesporen)enkwantitatieveeigenschappen(zoals aantalscherven,gewicht, potgrootte (diameter, wanddikte), fragmentatiegraad)vastgesteld.Deze basisgegevensvormenhetuitgangspuntvooreentypo-chronologischeindeling van hetaardewerkcomplex.323 +During the pottery analysis qualitative (such as for example magering, pot shape, firing method, decoration, edge and soil type, weathering, color, typology, periodization, secondary traces and post-depositional traces) and quantitative characteristics (such as number of sherds, weight, pot size (diameter, wall thickness), degree of fragmentation) are determined. These basic data form the starting point for a typo-chronological classification of the pottery complex. 282 282 283 -= Visresten =325 += Fishremains = 284 284 285 -== Aardenvoorkomen==327 +== Nature == 286 286 287 -In grote trekkensluitdebehandelingvanvisrestenaanbij hetgeen overdierlijkmateriaalgezegd is.Watde aardvanhetvismateriaalbetreft,kanonderscheidgemaakt wordentussendrie categorieën.Ten eerste isereenfundamenteelverschiltussenvissenmeteenoverwegendkraakbeenskeletenvissenmeteenbeenskelet.Vandeeerste categoriezalmenin hetalgemeenweinigtotnietsaantreffen,terwijl hetskeletvan beenvissennetzoresistentisalsdatvan vogelsen amfibieën.Dederdecategorievormendeschubben. Sommige schubben zijnstevigen compact,andereduidelijkopgebouwduitsegmenten. Schubbenvanhetlaatste typehebbeneneiging bij droginguit elkaarevallen.329 +In broad outlines, the treatment of fish remains is in line with what has been said about animal material. As far as the nature of the fish material is concerned, a distinction can be made between three categories. Firstly, there is a fundamental difference between fish with a predominantly cartilage skeleton and fish with a bone skeleton. Of the former category, one will generally find little or nothing, while the skeleton of bony fish is as resistant as that of birds and amphibians. The third category is the scales. Some scales are firm and compact, others clearly composed of segments. Scales of the latter type tend to fall apart when dried. 288 288 289 -== Onderzoek==331 +== Research == 290 290 291 - Onderzoekaanvismateriaalbiedt demogelijkheid vasttestellen,ofer sprakes van herkomstuit eenzoet-, brak-ofzoutwatermilieu.Vismateriaal speeltookeenrolbijhetreconstruerenvan devoedseleconomie, waarbijsoms (in historischecontext)ookstatusverschillen tussen socialemilieu’s kunnenwordenopgemerkt. Integenstellingtothetreguliereonderzoekaandierlijkmateriaalwordt vismateriaalnietgewogen.333 +Examination of fish material makes it possible to determine whether it originated in a freshwater, brackish or saltwater environment. Fish material also plays a role in reconstructing the food economy, whereby sometimes (in a historical context) status differences between social environments can be noted. In contrast to regular research on animal material, fish material is not weighed. 292 292 293 -= Vuursteen =335 += Flint = 294 294 295 -== Aardenvoorkomen==337 +== Nature == 296 296 297 - Voordeprehistorie, en dan vooralvoor desteentijd,isvuursteenéénvan debelangrijkste informatiebronnen.Vuursteenvergaatniet enwordtingroteaantallen aangetroffen.De verwerkingvanvuursteenvondstenin hetveld is nietzogecompliceerd alsbijanderemateriaalgroepen.In dithoofdstukgaathetuitsluitend overvuursteen, inclusief enkeleveelgebruiktekwartsietsoortendieopdezelfdewijzebewerktwordenalsvuursteen,enerschillendethema’sdie daarbij vanbelang zijn.Deaandachtisdaarbij vooralgerichtop de meestalgemeen voorkomendezaken. Onderwerpenzoalsde opzetvaneenonderzoek en deopgravingsmethodenen techniekenkomenhierniet aan bod. Niet alhetvuursteenopeenvindplaatswordt aangetroffenis daardoormensenaangevoerd. Indedelen vanNederlanddie in de Saale-ijstijdwarenbedektmetgletsjersenindedelenvanZuid-Limburgmetvuursteenrijkeafzettingenmoet ookrekening wordengehouden metniet doormensenbewerktvuursteen.Demensgebruikte vuursteenuit secundairebronnen: glacialeafzettingen, rivierenen strandenenuitprimairevoorkomens:dekalkafzettingeninZuid-Limburg.Zokaner eengrootaantal verschillendegrondstofgroepenwordenonderscheidenmetiedereigen specifiekekenmerken. Ook werd gebruik gemaaktvan kwartsietsoortendie uitslechtsenkele primairebronnenafkomstigzijn,zoals Wommersom in België.Hetonderzoek vangrondstoffenlevert veelinformatieoverlange-afstandcontacten.Vuursteen iszeer resistent,maartochkan verwering optreden.Op vuursteenzijndanverschillendeglans-enkleurveranderingenzichtbaar. Inveelgevallenisditookeenaanwijzingdat hetomoude,vaakpaleolithische, artefacten gaat.339 +For prehistory, especially the Stone Age, flint is one of the most important sources of information. Flint does not decay and is found in large numbers. Processing flint finds in the field is not as complicated as with other material groups. This chapter deals exclusively with flint, including some common quartzite types that are processed in the same way as flint, and the various themes involved. The focus is on the most commonly encountered issues. Topics such as survey design and excavation methods and techniques are not covered here. Not all flint found at a site has been brought there by people. In the parts of the Netherlands that were covered by glaciers during the Saale glaciation and in the parts of South Limburg with flint-rich deposits, flint not worked by humans must also be taken into account. Humans used flint from secondary sources: glacial deposits, rivers and beaches and from primary occurrences: the limestone deposits in South Limburg. Thus, a large number of different raw material groups can be distinguished, each with its own specific characteristics. Quartzite types from only a few primary sources were also used, such as Wommersom in Belgium. The examination of raw materials provides much information on long-distance contacts. Flint is very resistant, yet weathering can occur. Various gloss and color changes are then visible on flint. In many cases this is also an indication that these are ancient, often Paleolithic, artifacts. 298 298 299 -== Onderzoek==341 +== Research == 300 300 301 -D oor degrotehoeveelhedenvuursteendie inhetverledenbewerktzijn,isvuursteenbijuitstekgeschiktomvindplaatsenopteporen.Bijeenopgravingisnatuurlijk deruimtelijkeinformatie van grootbelang.Ditiso.a. de basisvoorhetkennenvanactiviteitengebiedenenhetafbakenenvanvindplaatsen.Ookhetrefittingonderzoek-waarbijgetrachtwordt allevuursteentjesweer aanelkaartepassen-levert hiereenbelangrijkebijdrageaan.De technischeanalysevandebewerkingvanhetvuursteen, hetonderzoekvandegebruiktegrondstoffen,dewerktuigtypologieen hetgebruikssporenonderzoek,zijn debelangrijksteonderzoeksmethodenomo.a.deouderdom, cultureletoewijzing,de matevan verstoringende functie vandevindplaatsvastte stellen.Hetzijnallemaal bouwstenenwaarmeeuiteindelijkeenpoging ondernomen kan wordenomeenreconstructietemakenvan water zichop devindplaatsinhetverledenheeftafgespeeld.343 +Due to the large quantities of flint worked in the past, flint is ideally suited for locating sites. In an excavation of course the spatial information is of great importance. This is the basis for the recognition of activity areas and the demarcation of sites. The refitting research -in which an attempt is made to fit all flints back together again- also makes an important contribution here. The technical analysis of the processing of the flint, the research of the raw materials used, the tool typology and the traces of use, are the most important research methods to determine the age, cultural attribution, the degree of disturbance and the function of the site. These are all building blocks with which an attempt can ultimately be made to reconstruct what happened at the site in the past. 302 302 303 -= Referen ties =345 += References = 304 304 305 305 * Bisdom, E.B.A., Henstra, S., Jongerius, A. enThiel, F., 1975: Energy-dispersive xray analysis on thin sections and unimpregnated soil material. Neth. J. Agric. Sci., 23 (2), 113-125. 306 306 * Bisdom, E.B.A., en Schoonderbeek, D., 1983. The characterization of the shape of mineral grains in this sections of soils by Quantimet and BESI. Geoderma 30, 303 - 332. ... ... @@ -319,4 +319,4 @@ 319 319 ))) 320 320 ))) 321 321 322 - ~)~)~)364 +